Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant ATP synthase subunit a (atpB)

This Recombinant ATP synthase subunit a (atpB) spans the amino acid sequence from region 1-251.

Product Specifications

Product Name Alternative

ATP synthase subunit a, ATP synthase F0 sector subunit a, F-ATPase subunit 6

UniProt

P45829

Expression Region

1-251

Origin

Mycobacterium leprae

Field of Research

Immunology & Inflammation; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTETILSGGQIEVGEHHTTTWFGMTVNTDTVLSTAIAAAIVIALAFFLRTKVNSTGVPCG MQLFWEAITVQMRTQIESAIGMRIAPFVLPLAVTIFVFILISNWLSVLPLQYTNADGHTT EVLSSAAADINYVLALAFFVFVCYHLAGIWRRGIVGHPVAVLKGHVAFLAPINLVEEITK PISLSLRLFGNIFAGGILVTLIALFPPYIMWAPNAIWKSFDLFVGAIQAFIFSILTILYF SQAMEVEDHHD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Calcineurin B / PPP3R1 (CALNB/2342), CF640R conjugate, 0.1mg/mL
BNC402342-500 1x 500 µL

Calcineurin B / PPP3R1 (CALNB/2342), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Elab Bright™ Violet 650 Rat IgG2a, κ Isotype Control[R35-95]
AN00822U 20 Tests

Elab Bright™ Violet 650 Rat IgG2a, κ Isotype Control[R35-95]

Sign In for Pricing
View Details
Purified Anti-Human CD27 Antibody[O323]
E-AB-F11400P-01 25 µg

Purified Anti-Human CD27 Antibody[O323]

Sign In for Pricing
View Details
Purified Anti-Human CD27 Antibody[O323]
E-AB-F11400P-02 100 µg

Purified Anti-Human CD27 Antibody[O323]

Sign In for Pricing
View Details
ZNF408 Polyclonal Antibody
E-AB-66454-01 60 µL

ZNF408 Polyclonal Antibody

Sign In for Pricing
View Details
ZNF408 Polyclonal Antibody
E-AB-66454-02 120 µL

ZNF408 Polyclonal Antibody

Sign In for Pricing
View Details