Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Protein CysZ (cysZ)

This Recombinant Protein CysZ (cysZ) spans the amino acid sequence from region 1-253.

Product Specifications

Product Name Alternative

Protein CysZ

UniProt

P0A6J4

Expression Region

1-253

Origin

Escherichia coli O157:H7

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MVSSFTSAPRSGFYYFAQGWKLVSQPGIRRFVILPLLVNILLMGGAFWWLFTQLDVWIPT LMSYVPDWLQWLSYLLWPLAVISVLLVFGYFFSTIANWIAAPFNGLLAEQLEARLTGATP PDTGIFGIMKDVPRIMKREWQKFAWYLPRAIVLLILYFIPGIGQTVAPVLWFLFSAWMLA IQYCDYPFDNHKVPFKEMRTALRTRKITNMQFGALTSLFTMIPLLNLFIMPVAVCGATAM WVDCYRDKHAMWR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ADAT2 Rabbit Polyclonal Antibody
orb624506-01 50 µg

ADAT2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
ADAT2 Rabbit Polyclonal Antibody
orb624506-02 100 µg

ADAT2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Rabbit Monoclonal NKX2.8 Antibody (NKX28/3233R) [FITC]
NBP3-08653F 100 µL

Rabbit Monoclonal NKX2.8 Antibody (NKX28/3233R) [FITC]

Sign In for Pricing
View Details
PELP1 ORF Vector (Human) (pORF)
36383011 1.0 µg DNA

PELP1 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
Rabbit anti-Ashbya gossypii (strain 10895/CBS 109.51/FGSC 9923/NRRL Y-1056)(Yeast)(Eremothecium gossypii) RPS29 Polyclonal Antibody
MBS7197731 Inquire

Rabbit anti-Ashbya gossypii (strain 10895/CBS 109.51/FGSC 9923/NRRL Y-1056)(Yeast)(Eremothecium gossypii) RPS29 Polyclonal Antibody

Sign In for Pricing
View Details
C15orf24 Recombinant Rabbit mAb
BS48614-01 50 µL

C15orf24 Recombinant Rabbit mAb

Sign In for Pricing
View Details