Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Protein CysZ (cysZ)

This Recombinant Protein CysZ (cysZ) spans the amino acid sequence from region 1-253.

Product Specifications

Product Name Alternative

Protein CysZ

UniProt

P0A6J4

Expression Region

1-253

Origin

Escherichia coli O157:H7

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MVSSFTSAPRSGFYYFAQGWKLVSQPGIRRFVILPLLVNILLMGGAFWWLFTQLDVWIPT LMSYVPDWLQWLSYLLWPLAVISVLLVFGYFFSTIANWIAAPFNGLLAEQLEARLTGATP PDTGIFGIMKDVPRIMKREWQKFAWYLPRAIVLLILYFIPGIGQTVAPVLWFLFSAWMLA IQYCDYPFDNHKVPFKEMRTALRTRKITNMQFGALTSLFTMIPLLNLFIMPVAVCGATAM WVDCYRDKHAMWR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Helicobacter pylori UPF0114 protein HPP12_0190 (HPP12_0190)
orb2919698-01 20 µg

Recombinant Helicobacter pylori UPF0114 protein HPP12_0190 (HPP12_0190)

Sign In for Pricing
View Details
Recombinant Helicobacter pylori UPF0114 protein HPP12_0190 (HPP12_0190)
orb2919698-02 100 µg

Recombinant Helicobacter pylori UPF0114 protein HPP12_0190 (HPP12_0190)

Sign In for Pricing
View Details
TIMELESS (NM_003920) Human Recombinant Protein
TP308527L 1 mg

TIMELESS (NM_003920) Human Recombinant Protein

Sign In for Pricing
View Details
TAF5L Antibody - N-terminal region : Biotin (ARP39081_P050-Biotin)
ARP39081_P050-Biotin 100 µL

TAF5L Antibody - N-terminal region : Biotin (ARP39081_P050-Biotin)

Sign In for Pricing
View Details
Rabbit Anti Human SYN1 Polyclonal Affinity Purified (PBS with 0.05% sodium azide and 50% glycerol, pH7.4) (Western Blot,IHC,ELISA) 200UL
IRBAHUSYN1AP16200UL 200 µL

Rabbit Anti Human SYN1 Polyclonal Affinity Purified (PBS with 0.05% sodium azide and 50% glycerol, pH7.4) (Western Blot,IHC,ELISA) 200UL

Sign In for Pricing
View Details
Anti-Human GFM1 Polyclonal Antibody
HP090014-01 50 µg

Anti-Human GFM1 Polyclonal Antibody

Sign In for Pricing
View Details