Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Enterococcus faecalis Membrane protein insertase YidC (yidC)

This Recombinant Enterococcus faecalis Membrane protein insertase YidC (yidC) spans the amino acid sequence from region 23-275.

Product Specifications

Product Name Alternative

Membrane protein insertase YidC, Foldase YidC, Membrane integrase YidC, Membrane protein YidC

UniProt

Q82YV1

Expression Region

23-275

Origin

Enterococcus faecalis (strain ATCC 700802 / V583)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

CGTAPVSESSTGIWDRYIVYYFAQAIKFLSLGGSVGIGIILFTLVIRIILLPLMHFQTKS MRKTQELQPQLKALQQKYSSKDPETQRLFREEQQRLYAENNVNPYIGCLPLLVQLPIMMA LYQAISRVPELKEGTFLWLSLDKPDPYLILPILAAVFTFASTYLSSMSQLETNASLKIMN YVMPAMIFFMGISLASSLSLYWVVSNAFQTGQTLLLNNPFKIRKEREEAARQAKARERAL ERAKSPKKKGKKK

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

TMC6 CRISPR/Cas9 KO Plasmid (h)
sc-407944 20 µg

TMC6 CRISPR/Cas9 KO Plasmid (h)

Sign In for Pricing
View Details
CCG-222740
S6673-5mg 5 mg

CCG-222740

Sign In for Pricing
View Details
PTPRQ shRNA Plasmid (h)
sc-45262-SH 20 µg

PTPRQ shRNA Plasmid (h)

Sign In for Pricing
View Details
YBR126W-B Antibody
orb849997 2 mg

YBR126W-B Antibody

Sign In for Pricing
View Details
Anti-ERCC6L Antibody Picoband® HRP Conjugated
A07663-1-HRP 100 µg/Vial

Anti-ERCC6L Antibody Picoband® HRP Conjugated

Sign In for Pricing
View Details
Rabbit Polyclonal ASPP1 Antibody [PerCP]
NB110-40683PCP 0.1 mL

Rabbit Polyclonal ASPP1 Antibody [PerCP]

Sign In for Pricing
View Details