Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Enterococcus faecalis Membrane protein insertase YidC (yidC)

This Recombinant Enterococcus faecalis Membrane protein insertase YidC (yidC) spans the amino acid sequence from region 23-275.

Product Specifications

Product Name Alternative

Membrane protein insertase YidC, Foldase YidC, Membrane integrase YidC, Membrane protein YidC

UniProt

Q82YV1

Expression Region

23-275

Origin

Enterococcus faecalis (strain ATCC 700802 / V583)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

CGTAPVSESSTGIWDRYIVYYFAQAIKFLSLGGSVGIGIILFTLVIRIILLPLMHFQTKS MRKTQELQPQLKALQQKYSSKDPETQRLFREEQQRLYAENNVNPYIGCLPLLVQLPIMMA LYQAISRVPELKEGTFLWLSLDKPDPYLILPILAAVFTFASTYLSSMSQLETNASLKIMN YVMPAMIFFMGISLASSLSLYWVVSNAFQTGQTLLLNNPFKIRKEREEAARQAKARERAL ERAKSPKKKGKKK

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

LDH-C shRNA Plasmid (h)
sc-45903-SH 20 µg

LDH-C shRNA Plasmid (h)

Sign In for Pricing
View Details
Hoefer 18 x 16 cm notched divider plate (5)
ghl1816n-5 1 Unit

Hoefer 18 x 16 cm notched divider plate (5)

Sign In for Pricing
View Details
CD48 (Biotin)
C2403-09C-Biotin 100 µL

CD48 (Biotin)

Sign In for Pricing
View Details
ADAMTS14 sgRNA CRISPR Lentivector (Human) (Target 2)
K0044803 1.0 µg DNA

ADAMTS14 sgRNA CRISPR Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
Olfr1325 (NM_146398) Mouse Tagged ORF Clone Lentiviral Particle
MR212676L3V 200 µL

Olfr1325 (NM_146398) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Cy3-Linked Polyclonal Antibody to Sialic Acid Binding Ig Like Lectin 5 (SIGLEC5)
MBS2050040-01 0.1 mL

Cy3-Linked Polyclonal Antibody to Sialic Acid Binding Ig Like Lectin 5 (SIGLEC5)

Sign In for Pricing
View Details