Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Macaca mulatta (Rhesus macaque) CD151 antigen (CD151)

This Recombinant Macaca mulatta (Rhesus macaque) CD151 antigen (CD151) spans the amino acid sequence from region 1-253.

Product Specifications

Product Name Alternative

CD151 antigen, Platelet-endothelial tetraspan antigen 3, PETA-3, CD_antigen= CD151

UniProt

P61171

Expression Region

1-253

Origin

Macaca mulatta (Rhesus macaque)

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGEFNEKKTTCGTVCLKYLLFTYNCCFWLAGLAVMAVGIWTLALKSDYISLLASGTYLAT AYILVVAGAVVMVTGVLGCCATFKERRNLLRLYFILLLIIFLLEIIAGVLAYVYYQQLNT ELKENLKDTMAKRYHQPGHEAVTSAVDQLQQEFHCCGSNNSQDWRDSEWIRLREARGRVV PDSCCKTVVAGCGQRDHAFNIYKVEGGFITKLETFIQEHLRVIGAVGTGIACVQVFGMIF TCCLYRSLKLEHY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GCM1 Mouse Monoclonal Antibody [Clone ID: OTI5A5]
CF810524 100 µg

GCM1 Mouse Monoclonal Antibody [Clone ID: OTI5A5]

Sign In for Pricing
View Details
Tmprss5 Mouse Gene Knockout Kit (CRISPR)
KN517943 1 Kit

Tmprss5 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
CD63 (LAMP3/968), CF647 conjugate, 0.1mg/mL
BNC470968-100 1x 100 µL

CD63 (LAMP3/968), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
BSCL2 (NM_032667) Human Recombinant Protein
TP303625L 1 mg

BSCL2 (NM_032667) Human Recombinant Protein

Sign In for Pricing
View Details
IFluor® 488 goat anti-mouse IgG (H+L)
16448-AAT 200 µg

IFluor® 488 goat anti-mouse IgG (H+L)

Sign In for Pricing
View Details
P21WAF1 (Tumor Suppressor Protein) (CIP1/2275R), CF647 conjugate, 0.1mg/mL
BNC472275-500 1x 500 µL

P21WAF1 (Tumor Suppressor Protein) (CIP1/2275R), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details