Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Streptococcus pneumoniae Membrane protein insertase YidC 2 (yidC2)

This Recombinant Streptococcus pneumoniae Membrane protein insertase YidC 2 (yidC2) spans the amino acid sequence from region 23-276.

Product Specifications

Product Name Alternative

Membrane protein insertase YidC 2, Foldase YidC 2, Membrane integrase YidC 2, Membrane protein YidC 2

UniProt

Q8DN93

Expression Region

23-276

Origin

Streptococcus pneumoniae (strain ATCC BAA-255 / R6)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

CATNGVTSDITAESADFWSKLVYFFAEIIRFLSFDISIGVGIILFTVLIRTVLLPVFQVQ MVASRKMQEAQPRIKALREQYPGRDMESRTKLEQEMRKVFKEMGVRQSDSLWPILIQMPV ILALFQALSRVDFLKTGHFLWINLGSVDTTLVLPILAAVFTFLSTWLSNKALSERNGATT AMMYGIPVLIFIFAVYAPGGVALYWTVSNAYQVLQTYFLNNPFKIIAEREAVVQAQKDLE NRKRKAKKKAQKTK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

9,10-Dihydro-9,10-ethanoanthracene-9-acrolein
TRC-D985220-1MG 1 mg

9,10-Dihydro-9,10-ethanoanthracene-9-acrolein

Sign In for Pricing
View Details
NAA60 (NM_001083600) Human Over-expression Lysate
LC421226 20 µg

NAA60 (NM_001083600) Human Over-expression Lysate

Sign In for Pricing
View Details
Peracetyl (R)-Empagliflozin
TRC-P149860-100MG 100 mg

Peracetyl (R)-Empagliflozin

Sign In for Pricing
View Details
U2AF1L3 (U2AF1L4) Mouse Monoclonal Antibody [Clone ID: OTI8B1]
CF810435 100 µg

U2AF1L3 (U2AF1L4) Mouse Monoclonal Antibody [Clone ID: OTI8B1]

Sign In for Pricing
View Details
PAM Human Gene Knockout Kit (CRISPR)
KN202074RB 1 Kit

PAM Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Myelin Basic Protein (MBP) (NM_001025090) Human Over-expression Lysate
LY422582 100 µg

Myelin Basic Protein (MBP) (NM_001025090) Human Over-expression Lysate

Sign In for Pricing
View Details