Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Streptococcus pneumoniae Membrane protein insertase YidC 2 (yidC2)

This Recombinant Streptococcus pneumoniae Membrane protein insertase YidC 2 (yidC2) spans the amino acid sequence from region 23-276.

Product Specifications

Product Name Alternative

Membrane protein insertase YidC 2, Foldase YidC 2, Membrane integrase YidC 2, Membrane protein YidC 2

UniProt

Q8DN93

Expression Region

23-276

Origin

Streptococcus pneumoniae (strain ATCC BAA-255 / R6)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

CATNGVTSDITAESADFWSKLVYFFAEIIRFLSFDISIGVGIILFTVLIRTVLLPVFQVQ MVASRKMQEAQPRIKALREQYPGRDMESRTKLEQEMRKVFKEMGVRQSDSLWPILIQMPV ILALFQALSRVDFLKTGHFLWINLGSVDTTLVLPILAAVFTFLSTWLSNKALSERNGATT AMMYGIPVLIFIFAVYAPGGVALYWTVSNAYQVLQTYFLNNPFKIIAEREAVVQAQKDLE NRKRKAKKKAQKTK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

OR10G2 (N-term) Rabbit Polyclonal Antibody
AP53005PU-N 400 µL

OR10G2 (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
ProPette™ LE Multi-Channel Pipettor
P5212-200U 1 Each

ProPette™ LE Multi-Channel Pipettor

Sign In for Pricing
View Details
FITC-conjugated Flag-Tag Monoclonal Antibody
AN00299C-01 25 µL

FITC-conjugated Flag-Tag Monoclonal Antibody

Sign In for Pricing
View Details
FITC-conjugated Flag-Tag Monoclonal Antibody
AN00299C-02 100 µL

FITC-conjugated Flag-Tag Monoclonal Antibody

Sign In for Pricing
View Details
Frozen Tissue Sections, Tendon
CS634230 5x 5 µm

Frozen Tissue Sections, Tendon

Sign In for Pricing
View Details
CMV TaqMan Probe/Primer and Control Set
TM36310 100 Reactions

CMV TaqMan Probe/Primer and Control Set

Sign In for Pricing
View Details