Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Photobacterium profundum ATP synthase subunit a 2 (atpB2)

This Recombinant Photobacterium profundum ATP synthase subunit a 2 (atpB2) spans the amino acid sequence from region 1-255.

Product Specifications

Product Name Alternative

ATP synthase subunit a 2, ATP synthase F0 sector subunit a 2, F-ATPase subunit 6 2

UniProt

Q6LL02

Expression Region

1-255

Origin

Photobacterium profundum (Photobacterium sp. (strain SS9) )

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDNVSSAHEYIEHHLTFLTLGKGFWSINIDSMIMVWMVGLLFIGVFRYVAIRGTKGVPGR LQCFIEITFDFVNNLVKEIFKTEDKLIGPLALTIFVWVFLMNSIDLLPVDFVPALTRLFG VEHFRDLPSADVNVPVSMALGVFILIIGYTLKNKGIVGFIKELTTQPFEHPLLYPVNFLL ELITLISKPISLGLRLFGNMYAGEMIFILIALMPWWMQWALSVPWALFHILIVFLQAFIF MVLTIVYLAMATEEH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD31 / PECAM-1 (158-2B3), CF647 conjugate, 0.1mg/mL
BNC470352-500 1x 500 µL

CD31 / PECAM-1 (158-2B3), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
FOXP3 (3G3), CF568 conjugate, 0.1mg/mL
BNC680645-100 1x 100 µL

FOXP3 (3G3), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Spectrin Alpha 1 (Erythrocyte Marker) (SPTA1/1832), CF740 conjugate, 0.1mg/mL
BNC741832-100 1x 100 µL

Spectrin Alpha 1 (Erythrocyte Marker) (SPTA1/1832), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Chromogranin A / CHGA (Neuroendocrine Marker) (rCHGA/798), CF740 conjugate, 0.1mg/mL
BNC741917-100 1x 100 µL

Chromogranin A / CHGA (Neuroendocrine Marker) (rCHGA/798), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
P21 / WAF1 (HJ21), CF647 conjugate, 0.1mg/mL
BNC470984-500 1x 500 µL

P21 / WAF1 (HJ21), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD50 (ICAM-3) (ICAM3/1019), CF647 conjugate, 0.1mg/mL
BNC471019-100 1x 100 µL

CD50 (ICAM-3) (ICAM3/1019), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details