Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Chicken Protein orai-2 (ORAI2)

This Recombinant Chicken Protein orai-2 (ORAI2) spans the amino acid sequence from region 1-257.

Product Specifications

Product Name Alternative

Protein orai-2, Transmembrane protein 142B

UniProt

Q5ZLW2

Expression Region

1-257

Origin

Gallus gallus (Chicken)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSSELNVPVDPSTPACCSEPGTKGMDYRDWVRRSYLELVTSNHHSVQALSWRKLYLSRAK LKASSRTSALLSGFAMVAMVEVQLEMQYKYPQMLLIAFSACTTVLVAVHLFALLISTCIL PNVEAVSNIHNLNSISESPHERMHPYIELAWGFSTVLGILLFLAEVVLLCWIKFLPVDSI LKNDTTTIQKPSGHAGWQAALVSTIIMVPVGLIFVVFTIHFYRSLVRHKTERHNREIEEL HKLKVQLDGHDRGMQVV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HIST3H3 Rabbit Polyclonal Antibody (N-term)
E28PB2636 100 µL

HIST3H3 Rabbit Polyclonal Antibody (N-term)

Sign In for Pricing
View Details
GDI1 Antibody
A16146-100UG 100 µg

GDI1 Antibody

Sign In for Pricing
View Details
PJA1 AAV Vector (Mouse) (CMV)
36859105 1 µg

PJA1 AAV Vector (Mouse) (CMV)

Sign In for Pricing
View Details
Sirtuin 4 (SIRT4) Polyclonal Antibody
CAU22620-01 100 µL

Sirtuin 4 (SIRT4) Polyclonal Antibody

Sign In for Pricing
View Details
Sirtuin 4 (SIRT4) Polyclonal Antibody
CAU22620-02 200 µL

Sirtuin 4 (SIRT4) Polyclonal Antibody

Sign In for Pricing
View Details
Sirtuin 4 (SIRT4) Polyclonal Antibody
CAU22620-03 1 mL

Sirtuin 4 (SIRT4) Polyclonal Antibody

Sign In for Pricing
View Details