Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Chicken Protein orai-2 (ORAI2)

This Recombinant Chicken Protein orai-2 (ORAI2) spans the amino acid sequence from region 1-257.

Product Specifications

Product Name Alternative

Protein orai-2, Transmembrane protein 142B

UniProt

Q5ZLW2

Expression Region

1-257

Origin

Gallus gallus (Chicken)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSSELNVPVDPSTPACCSEPGTKGMDYRDWVRRSYLELVTSNHHSVQALSWRKLYLSRAK LKASSRTSALLSGFAMVAMVEVQLEMQYKYPQMLLIAFSACTTVLVAVHLFALLISTCIL PNVEAVSNIHNLNSISESPHERMHPYIELAWGFSTVLGILLFLAEVVLLCWIKFLPVDSI LKNDTTTIQKPSGHAGWQAALVSTIIMVPVGLIFVVFTIHFYRSLVRHKTERHNREIEEL HKLKVQLDGHDRGMQVV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

C12orf4 shRNA (h) Lentiviral Particles
sc-95913-V 200 µL

C12orf4 shRNA (h) Lentiviral Particles

Sign In for Pricing
View Details
Recombinant Human RFWD3 Protein
E30P7847 20 µg

Recombinant Human RFWD3 Protein

Sign In for Pricing
View Details
DLX2 Rabbit Polyclonal Antibody
orb500745-01 50 μL

DLX2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
DLX2 Rabbit Polyclonal Antibody
orb500745-02 100 µL

DLX2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
DLX2 Rabbit Polyclonal Antibody
orb500745-03 200 µL

DLX2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Anti-Flag Affinity Gel
P2282-0.5ml 0.5 mL

Anti-Flag Affinity Gel

Sign In for Pricing
View Details