Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rubrobacter xylanophilus ATP synthase subunit a (atpB)

This Recombinant Rubrobacter xylanophilus ATP synthase subunit a (atpB) spans the amino acid sequence from region 1-258.

Product Specifications

Product Name Alternative

ATP synthase subunit a, ATP synthase F0 sector subunit a, F-ATPase subunit 6

UniProt

Q1AVH3

Expression Region

1-258

Origin

Rubrobacter xylanophilus (strain DSM 9941 / NBRC 16129)

Field of Research

Immunology & Inflammation; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEVTQEELRHEILHTWEAAREAWVIHLEIAGINLSINKPVWFLWLGAAITFLFMYVGART LRDRPGAYQVLVEELFRFGRDMFGGQINEEGRKWFPYSLTLFIFLLVLNIIGLFPNSYPV TSNISFTATLALFTFVLTQYEGVRRNGLVTYLKSWAPADLPAKPLMYPIMWFLHLIQEFT KPLTLALRLYANILAGHLIIFVFLSLILYFGLPTAFVSVPFAVVFYAFEIFVAVIQAYIF AILTQVYIELAMFAEEAH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Mouse Ceacam1 Protein (His Tag)
PDMM100233-01 20 µg

Recombinant Mouse Ceacam1 Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Mouse Ceacam1 Protein (His Tag)
PDMM100233-02 100 µg

Recombinant Mouse Ceacam1 Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Mouse Ceacam1 Protein (His Tag)
PDMM100233-03 500 µg

Recombinant Mouse Ceacam1 Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Mouse Ceacam1 Protein (His Tag)
PDMM100233-04 1 mg

Recombinant Mouse Ceacam1 Protein (His Tag)

Sign In for Pricing
View Details
IL31 Antibody
KC-8322-01 50 μL

IL31 Antibody

Sign In for Pricing
View Details
IL31 Antibody
KC-8322-02 100 µL

IL31 Antibody

Sign In for Pricing
View Details