Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Synaptophysin-like protein 1 (SYPL1)

This Recombinant Human Synaptophysin-like protein 1 (SYPL1) spans the amino acid sequence from region 1-259.

Product Specifications

Product Name Alternative

Synaptophysin-like protein 1, Pantophysin

UniProt

Q16563

Expression Region

1-259

Origin

Homo sapiens (Human)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAPNIYLVRQRISRLGQRMSGFQINLNPLKEPLGFIKVLEWIASIFAFATCGGFKGQTEI QVNCPPAVTENKTVTATFGYPFRLNEASFQPPPGVNICDVNWKDYVLIGDYSSSAQFYVT FAVFVFLYCIAALLLYVGYTSLYLDSRKLPMIDFVVTLVATFLWLVSTSAWAKALTDIKI ATGHNIIDELPPCKKKAVLCYFGSVTSMGSLNVSVIFGFLNMILWGGNAWFVYKETSLHS PSNTSAPHSQGGIPPPTGI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ABCD2 Antibody
A67365-100UG 100 µg

ABCD2 Antibody

Sign In for Pricing
View Details
Mouse Clgn Pre-designed siRNA Set B
SI102711B 1 Each

Mouse Clgn Pre-designed siRNA Set B

Sign In for Pricing
View Details
PANX3 Protein Vector (Human) (pPB-C-His)
PV109594 500 ng

PANX3 Protein Vector (Human) (pPB-C-His)

Sign In for Pricing
View Details
WNK1 Antibody (C-Term)
E45M08518G-4 50 µL

WNK1 Antibody (C-Term)

Sign In for Pricing
View Details
Rat Gelsolin ELISA Kit
CN-01910R2 48T

Rat Gelsolin ELISA Kit

Sign In for Pricing
View Details
VGF Human Over-expression Lysate
orb1345467 100 µg

VGF Human Over-expression Lysate

Sign In for Pricing
View Details