Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Synaptophysin-like protein 1 (SYPL1)

This Recombinant Human Synaptophysin-like protein 1 (SYPL1) spans the amino acid sequence from region 1-259.

Product Specifications

Product Name Alternative

Synaptophysin-like protein 1, Pantophysin

UniProt

Q16563

Expression Region

1-259

Origin

Homo sapiens (Human)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAPNIYLVRQRISRLGQRMSGFQINLNPLKEPLGFIKVLEWIASIFAFATCGGFKGQTEI QVNCPPAVTENKTVTATFGYPFRLNEASFQPPPGVNICDVNWKDYVLIGDYSSSAQFYVT FAVFVFLYCIAALLLYVGYTSLYLDSRKLPMIDFVVTLVATFLWLVSTSAWAKALTDIKI ATGHNIIDELPPCKKKAVLCYFGSVTSMGSLNVSVIFGFLNMILWGGNAWFVYKETSLHS PSNTSAPHSQGGIPPPTGI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TIPRL, CT (TIPRL, TIP41-like protein, Putative MAPK-activating protein PM10, Type 2A-interacting protein)
042855 200 µL

TIPRL, CT (TIPRL, TIP41-like protein, Putative MAPK-activating protein PM10, Type 2A-interacting protein)

Sign In for Pricing
View Details
ANGPTL2 Protein Vector (Human) (pPB-C-His)
PV001601 500 ng

ANGPTL2 Protein Vector (Human) (pPB-C-His)

Sign In for Pricing
View Details
STK19, NT (Serine/Threonine-protein Kinase 19, G11, Protein G11, Protein RP1, RP1)
S4283-30A 200 µL

STK19, NT (Serine/Threonine-protein Kinase 19, G11, Protein G11, Protein RP1, RP1)

Sign In for Pricing
View Details
Nac1, ID (BTB/POZ domain-containing protein 14B, Nucleus accumbens-1, NAC1, BTBD14B) (MaxLight 650) discontinued
N7200-02B-ML650 100 µL

Nac1, ID (BTB/POZ domain-containing protein 14B, Nucleus accumbens-1, NAC1, BTBD14B) (MaxLight 650) discontinued

Sign In for Pricing
View Details
Rabbit Polyclonal LZTS2 Antibody [Biotin]
NBP2-41099B 0.1 mL

Rabbit Polyclonal LZTS2 Antibody [Biotin]

Sign In for Pricing
View Details
SKA2 Rabbit Polyclonal Antibody (HRP)
orb2607922 100 µg

SKA2 Rabbit Polyclonal Antibody (HRP)

Sign In for Pricing
View Details