Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Synaptophysin-like protein 1 (SYPL1)

This Recombinant Human Synaptophysin-like protein 1 (SYPL1) spans the amino acid sequence from region 1-259.

Product Specifications

Product Name Alternative

Synaptophysin-like protein 1, Pantophysin

UniProt

Q16563

Expression Region

1-259

Origin

Homo sapiens (Human)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAPNIYLVRQRISRLGQRMSGFQINLNPLKEPLGFIKVLEWIASIFAFATCGGFKGQTEI QVNCPPAVTENKTVTATFGYPFRLNEASFQPPPGVNICDVNWKDYVLIGDYSSSAQFYVT FAVFVFLYCIAALLLYVGYTSLYLDSRKLPMIDFVVTLVATFLWLVSTSAWAKALTDIKI ATGHNIIDELPPCKKKAVLCYFGSVTSMGSLNVSVIFGFLNMILWGGNAWFVYKETSLHS PSNTSAPHSQGGIPPPTGI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-ICA1 Antibody Picoband® Fluoro488 Conjugated
PB9495-Fluoro488 100 µg/Vial

Anti-ICA1 Antibody Picoband® Fluoro488 Conjugated

Sign In for Pricing
View Details
RPL7P55 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
41917111 3x 1.0 µg

RPL7P55 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
Recombinant Varicella Zoster Virus VZV ORF26 Protein, Untagged, E.coli-500ug
QP13951-500ug 500ug

Recombinant Varicella Zoster Virus VZV ORF26 Protein, Untagged, E.coli-500ug

Sign In for Pricing
View Details
Vsig4 3'UTR Luciferase Stable Cell Line
TU122154 1.0 mL

Vsig4 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
NDFIP1 3'UTR Lenti-reporter-Luc Vector
31593081 1.0 µg

NDFIP1 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
HPLC Column, NH2,3μm,120Å,4.0x50mm
13011643 1 PC

HPLC Column, NH2,3μm,120Å,4.0x50mm

Sign In for Pricing
View Details