Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mustela vison Uroplakin-1b (UPK1B)

This Recombinant Mustela vison Uroplakin-1b (UPK1B) spans the amino acid sequence from region 2-260.

Product Specifications

Product Name Alternative

Uroplakin-1b, UP1b, Protein TI 1, Uroplakin Ib, UPIb

UniProt

P30413

Expression Region

2-260

Origin

Mustela vison (American mink) (Neovison vison)

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

AKDDSSVRCFQGLLIFGNVIVGMCGIALTAECIFFVSDQHSLYPLLEATDNDDIYGAAWI GMFVGICLFCLSVLGIVGIMKSNRKILLAYFILMFIVYGFEVASCITAATQRDFFTPNLF LKQMLERYQNNSPPNNDDQWKNNGVTKTWDRLMLQDHCCGVNGPSDWQRYTSAFRTANND ADYPWPRQCCVMNSLKEPLNVEACKLGVPGYYHKEGCYELISGPMNRHAWGVAWFGFAIL CWTFWVLLGTMFYWSRIEY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MAGE A1 (MA454), CF640R conjugate, 0.1mg/mL
BNC400008-500 1x 500 µL

MAGE A1 (MA454), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Complement C4d (C4D204), CF568 conjugate, 0.1mg/mL
BNC680204-500 1x 500 µL

Complement C4d (C4D204), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HSP27 (G3.1), CF405S conjugate, 0.1mg/mL
BNC040861-500 1x 500 µL

HSP27 (G3.1), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD31 / PECAM-1 (C31.3), CF488A conjugate, 0.1mg/mL
BNC880049-100 1x 100 µL

CD31 / PECAM-1 (C31.3), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD106 / VCAM1 (VCAM1/843), CF488A conjugate, 0.1mg/mL
BNC880843-100 1x 100 µL

CD106 / VCAM1 (VCAM1/843), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
ACTH (Adrenocorticotrophic Hormone) (AH26 + 57), CF405S conjugate, 0.1mg/mL
BNC041025-500 1x 500 µL

ACTH (Adrenocorticotrophic Hormone) (AH26 + 57), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details