Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bovine Claudin-18 (CLDN18)

This Recombinant Bovine Claudin-18 (CLDN18) spans the amino acid sequence from region 1-261.

Product Specifications

Product Name Alternative

Claudin-18

UniProt

Q0VCN0

Expression Region

1-261

Origin

Bos taurus (Bovine)

Field of Research

Cancer Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSTTRCQVVGFLLSILGLAGCIVATEMDMWSTQDLYDNPVTAVFQYEGLWRSCVQQSSGF TECRPYLTILGLPAMLQAVRALMIVGIVLSVIGLLVAIFALKCIRMGNMDDSAKAKMTLT SGIMFIIAGLCAIAGVSVFANMLVTNFWMSTASMFTSMGGMVQTVQTRYTFGAALFVGWV AGGLTLIGGVLMCIACRGLAPEETNYKAVSYHASGHNVAYRPGGFKASSGFESNTRNKKI YDGGARTEDEGQSPPSKYDYV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

P21 / WAF1 (WA-1), CF594 conjugate, 0.1mg/mL
BNC940043-100 1x 100 µL

P21 / WAF1 (WA-1), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD7 (T3-3A1), CF568 conjugate, 0.1mg/mL
BNC680978-100 1x 100 µL

CD7 (T3-3A1), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD34 (ICO-115), CF405S conjugate, 0.1mg/mL
BNC040039-100 1x 100 µL

CD34 (ICO-115), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MUC1 / CA15-3 / EMA / CD227 (Epithelial Marker) (MUC1/1887R), CF568 conjugate, 0.1mg/mL
BNC681887-100 1x 100 µL

MUC1 / CA15-3 / EMA / CD227 (Epithelial Marker) (MUC1/1887R), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Neurofilament (NF-L) (NFL/736), CF594 conjugate, 0.1mg/mL
BNC940736-100 1x 100 µL

Neurofilament (NF-L) (NFL/736), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD35 / CR1 (CR1/802), CF640R conjugate, 0.1mg/mL
BNC400802-500 1x 500 µL

CD35 / CR1 (CR1/802), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details