Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Chicken Gap junction beta-6 protein (GJB6)

This Recombinant Chicken Gap junction beta-6 protein (GJB6) spans the amino acid sequence from region 1-263.

Product Specifications

Product Name Alternative

Gap junction beta-6 protein, Connexin-31, Cx31

UniProt

O93533

Expression Region

1-263

Origin

Gallus gallus (Chicken)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDWGALQTILGGVNKHSTSIGKIWLTVLFIFRIMILVVAAERVWGDEQDDFICNTLQPGC KNVCYDHFFPISHIRLWALQLIFVSTPALLVAMHVAYRRHEKKRQFRKGDQKCEYKDIEE IRTQRFRIEGTLWWTYTCSIFFRLVFEAVFMYAFYFMYDGFRMPRLMKCSAWPCPNTVDC FVSRPTEKTVFTIFMIAVSSICILLNVAELCYLLTKFFLRRSRKAGNQKHHPNHENKEET KQNEMNELISDSCQNTVIGFTSS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DPEP1 (NM_004413) Human Over-expression Lysate
LY401402 100 µg

DPEP1 (NM_004413) Human Over-expression Lysate

Sign In for Pricing
View Details
FITC Anti-Mouse CD106 Antibody[M/K-2.7]
E-AB-F1091C-01 50 Tests

FITC Anti-Mouse CD106 Antibody[M/K-2.7]

Sign In for Pricing
View Details
FITC Anti-Mouse CD106 Antibody[M/K-2.7]
E-AB-F1091C-02 100 Tests

FITC Anti-Mouse CD106 Antibody[M/K-2.7]

Sign In for Pricing
View Details
FITC Anti-Mouse CD106 Antibody[M/K-2.7]
E-AB-F1091C-03 2x 100 Tests

FITC Anti-Mouse CD106 Antibody[M/K-2.7]

Sign In for Pricing
View Details
Tissue Total RNA, Fallopian tube
CR562919 5 µg

Tissue Total RNA, Fallopian tube

Sign In for Pricing
View Details
IL 1RA Porcine
OM296660-01 20 µg

IL 1RA Porcine

Sign In for Pricing
View Details