Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus subtilis Uncharacterized protein yebC (yebC)

This Recombinant Bacillus subtilis Uncharacterized protein yebC (yebC) spans the amino acid sequence from region 1-267.

Product Specifications

Product Name Alternative

Uncharacterized protein yebC

UniProt

O34341

Expression Region

1-267

Origin

Bacillus subtilis (strain 168)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTEERKETFEEEINQSERIDADEEPLSRMSRKASRQSKQKQKQKQKPRQERGESTVKDKL ASVWAAINRYCGFAFSILKSPAKTVVTDGFSHYKYGLISMLIFSIIFSIGNWFQLKASWN RPLGFGERHHAFYDGFLVVLVYLLIFFAVMVFAIWAVSRYMMKQKVTFREAAAVLGSLLV PVIAVSILWLIFAIVNIPMLTVLFTVLILFSIFFIIALYVQRVYQAAQDAPIDYIYCVFA VVAIALLFTAVTWPFISEYITASLIPL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SSFA2 Antibody - C-terminal region (ARP66284_P050)
ARP66284_P050 100 µL

SSFA2 Antibody - C-terminal region (ARP66284_P050)

Sign In for Pricing
View Details
C20ORF85 Rabbit Polyclonal Antibody
orb55695 100 µL

C20ORF85 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
GFP hsa-miR-6761-3p AAV miRNA Vector
Amh1239600 500 ng

GFP hsa-miR-6761-3p AAV miRNA Vector

Sign In for Pricing
View Details
2×Realab Green PCR Fast mixture (Universal)
R0202-01 100T (1ml)

2×Realab Green PCR Fast mixture (Universal)

Sign In for Pricing
View Details
ABCB7 CRISPR All-in-one AAV vector set (with saCas9)(Mouse)
11040154 3x 1.0 µg DNA

ABCB7 CRISPR All-in-one AAV vector set (with saCas9)(Mouse)

Sign In for Pricing
View Details
NUDCD2
487347 100 µL

NUDCD2

Sign In for Pricing
View Details