Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus subtilis Uncharacterized protein yebC (yebC)

This Recombinant Bacillus subtilis Uncharacterized protein yebC (yebC) spans the amino acid sequence from region 1-267.

Product Specifications

Product Name Alternative

Uncharacterized protein yebC

UniProt

O34341

Expression Region

1-267

Origin

Bacillus subtilis (strain 168)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTEERKETFEEEINQSERIDADEEPLSRMSRKASRQSKQKQKQKQKPRQERGESTVKDKL ASVWAAINRYCGFAFSILKSPAKTVVTDGFSHYKYGLISMLIFSIIFSIGNWFQLKASWN RPLGFGERHHAFYDGFLVVLVYLLIFFAVMVFAIWAVSRYMMKQKVTFREAAAVLGSLLV PVIAVSILWLIFAIVNIPMLTVLFTVLILFSIFFIIALYVQRVYQAAQDAPIDYIYCVFA VVAIALLFTAVTWPFISEYITASLIPL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PE-Labeled Human MSP1D1 Protein, His Tag (Nanodisc) (Site-specific conjugation)
APO-HP1E3-200tests 200 Tests

PE-Labeled Human MSP1D1 Protein, His Tag (Nanodisc) (Site-specific conjugation)

Sign In for Pricing
View Details
FSCN3 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)
K0816006 1.0 µg DNA

FSCN3 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
ELISA Kit For Retinoic acid receptor RXR-beta
E10636r 96 Tests

ELISA Kit For Retinoic acid receptor RXR-beta

Sign In for Pricing
View Details
RCAN1 Antibody
MBS9510103-01 0.05 mL

RCAN1 Antibody

Sign In for Pricing
View Details
RCAN1 Antibody
MBS9510103-02 0.1 mL

RCAN1 Antibody

Sign In for Pricing
View Details
RCAN1 Antibody
MBS9510103-03 5x 0.1 mL

RCAN1 Antibody

Sign In for Pricing
View Details