Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Psychromonas ingrahamii ATP synthase subunit a (atpB)

This Recombinant Psychromonas ingrahamii ATP synthase subunit a (atpB) spans the amino acid sequence from region 1-267.

Product Specifications

Product Name Alternative

ATP synthase subunit a, ATP synthase F0 sector subunit a, F-ATPase subunit 6

UniProt

A1T0Z5

Expression Region

1-267

Origin

Psychromonas ingrahamii (strain 37)

Field of Research

Immunology & Inflammation; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLTSSGYIQHHLTNAQMCTVDGSIAFNYACADAGFWTWHIDSLLFSVGLGVLFLFVFYKV GQKATTGVPGKLQCAVEMLMEFVSNAVKDSFHGRSPVIAPLALTIFVWILLMNTMDLIPV DFIPEAAKQILGVPYLKVVPTTDMNITFGLSLSVFALIVFYSIKIKGITGFVKELTLQPF NHWAFIPVNFILETIALIAKPISLSLRLFGNLYAGELIFILIALMPWWSQAALSVPWAIF HILVIVLQAFIFMMLTIVYLSMAHEDH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD3e (CRIS-7), CF640R conjugate, 0.1mg/mL
BNC401050-100 1x 100 µL

CD3e (CRIS-7), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD3e (CRIS-7), CF568 conjugate, 0.1mg/mL
BNC681050-100 1x 100 µL

CD3e (CRIS-7), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD47 (B6H12.2), CF594 conjugate, 0.1mg/mL
BNC940437-500 1x 500 µL

CD47 (B6H12.2), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Histone H1 (AE-4), CF405S conjugate, 0.1mg/mL
BNC040096-500 1x 500 µL

Histone H1 (AE-4), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD7 (T3-3A1), CF488A conjugate, 0.1mg/mL
BNC880978-500 1x 500 µL

CD7 (T3-3A1), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MAGE A1 (MA454), CF594 conjugate, 0.1mg/mL
BNC940008-500 1x 500 µL

MAGE A1 (MA454), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details