Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Probable lipid phosphate phosphatase PPAPDC3 (Ppapdc3)

This Recombinant Rat Probable lipid phosphate phosphatase PPAPDC3 (Ppapdc3) spans the amino acid sequence from region 1-271.

Product Specifications

Product Name Alternative

Probable lipid phosphate phosphatase PPAPDC3, EC= 3.1.3.-, Phosphatidic acid phosphatase type 2 domain-containing protein 3

UniProt

Q5FVJ3

Expression Region

1-271

Origin

Rattus norvegicus (Rat)

Field of Research

Metabolism Research; Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MPVSQSRARARDRNNVLNRAEFLSLNQPPKGTQEPRSSGRKASGPSTQPPPSSDGARERR QSQQLPEEDCMQLNPSFKGIAFNSLLAIDICMSKRLGVCAGRAASWASARSMVKLIGITS HGIPWIGGTILCLVRSSTLAGQEVLMNLLLALLLDIMTVAGVQKLIKRRGPYETSPGLLD YLTMDIYAFPAGHASRAAMVSKFFLSHLVLAVPLRVLLVLWAFCVGLSRVMIGRHHITDV ISGFIIGYFQFRLVELVWMSSNTCQMLISAW

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human RPS2 qPCR Primer Pair
QH21965S 200 Tests

Human RPS2 qPCR Primer Pair

Sign In for Pricing
View Details
2310061C15Rik siRNA (m)
sc-108717 10 µM

2310061C15Rik siRNA (m)

Sign In for Pricing
View Details
Tissue Factor
T5575-03 100 µg

Tissue Factor

Sign In for Pricing
View Details
Escherichia coli Shiga toxin 2 subunit B/stx2eB Nanobody
E55A15456 100 µg

Escherichia coli Shiga toxin 2 subunit B/stx2eB Nanobody

Sign In for Pricing
View Details
Rabbit Monoclonal EphB1 Antibody (022) [HRP]
NBP2-90032H 0.1 mL

Rabbit Monoclonal EphB1 Antibody (022) [HRP]

Sign In for Pricing
View Details
Phospho-p27 KIP 1 (Ser10) Recombinant Rabbit mAb
orb2327386-01 25 µL

Phospho-p27 KIP 1 (Ser10) Recombinant Rabbit mAb

Sign In for Pricing
View Details