Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Salmonella paratyphi C ATP synthase subunit a (atpB)

This Recombinant Salmonella paratyphi C ATP synthase subunit a (atpB) spans the amino acid sequence from region 1-271.

Product Specifications

Product Name Alternative

ATP synthase subunit a, ATP synthase F0 sector subunit a, F-ATPase subunit 6

UniProt

C0Q2N8

Expression Region

1-271

Origin

Salmonella paratyphi C (strain RKS4594)

Field of Research

Infectious Disease & Virology; Immunology & Inflammation; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MASENMTPQEYIGHHLNNLQLDLRTFSLVDPQNPPATFWTLNIDSMFFSVVLGLLFLVMF RSVAKKATSGVPGKFQTAIELIVGFVHGSVKDMYHGKSKLIAPLALTIFVWVFLMNLMDL LPIDLLPYIAEHWLGLPATRVVPSADVNITLSMALGVFILILFYSIKMKGIGGFAKELTL QPFNHWAFIPVNLILEGVSLLSKPVSLGLRLFGNMYAGELIFILIAGLLPWWSQWILNVP WAIFHILIITLQAFIFMVLTIVYLSMASEEH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

VPS25 Human Gene Knockout Kit (CRISPR)
KN402487 1 Kit

VPS25 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
3'-Azido-3'-deoxythymidine Beta-D-glucuronide, Sodium Salt
TRC-A825050-5MG 5 mg

3'-Azido-3'-deoxythymidine Beta-D-glucuronide, Sodium Salt

Sign In for Pricing
View Details
VAV3 (NM_006113) Human Recombinant Protein
TP320550M 100 µg

VAV3 (NM_006113) Human Recombinant Protein

Sign In for Pricing
View Details
TIM3 / HAVCR2 / CD366 (Effector T-Cell Marker) (TIM3/3113), CF640R conjugate, 0.1mg/mL
BNC403113-100 1x 100 µL

TIM3 / HAVCR2 / CD366 (Effector T-Cell Marker) (TIM3/3113), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Thrombin Receptor (F2R) (NM_001992) Human Over-expression Lysate
LY400726 100 µg

Thrombin Receptor (F2R) (NM_001992) Human Over-expression Lysate

Sign In for Pricing
View Details
Scgb2b2 Mouse Gene Knockout Kit (CRISPR)
KN515364 1 Kit

Scgb2b2 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details