Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Salmonella paratyphi C ATP synthase subunit a (atpB)

This Recombinant Salmonella paratyphi C ATP synthase subunit a (atpB) spans the amino acid sequence from region 1-271.

Product Specifications

Product Name Alternative

ATP synthase subunit a, ATP synthase F0 sector subunit a, F-ATPase subunit 6

UniProt

C0Q2N8

Expression Region

1-271

Origin

Salmonella paratyphi C (strain RKS4594)

Field of Research

Infectious Disease & Virology; Immunology & Inflammation; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MASENMTPQEYIGHHLNNLQLDLRTFSLVDPQNPPATFWTLNIDSMFFSVVLGLLFLVMF RSVAKKATSGVPGKFQTAIELIVGFVHGSVKDMYHGKSKLIAPLALTIFVWVFLMNLMDL LPIDLLPYIAEHWLGLPATRVVPSADVNITLSMALGVFILILFYSIKMKGIGGFAKELTL QPFNHWAFIPVNLILEGVSLLSKPVSLGLRLFGNMYAGELIFILIAGLLPWWSQWILNVP WAIFHILIITLQAFIFMVLTIVYLSMASEEH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CF®640R-dUTP, Lyophilized Powder
#40007 1x 25 nmol

CF®640R-dUTP, Lyophilized Powder

Sign In for Pricing
View Details
ICOS Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI5H1]
TA813215AM 100 µL

ICOS Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI5H1]

Sign In for Pricing
View Details
FGG Polyclonal Antibody
E-AB-40412-01 25 µL

FGG Polyclonal Antibody

Sign In for Pricing
View Details
FGG Polyclonal Antibody
E-AB-40412-02 100 µL

FGG Polyclonal Antibody

Sign In for Pricing
View Details
HDAC7 Polyclonal Antibody
E-AB-61619-01 60 µL

HDAC7 Polyclonal Antibody

Sign In for Pricing
View Details
HDAC7 Polyclonal Antibody
E-AB-61619-02 120 µL

HDAC7 Polyclonal Antibody

Sign In for Pricing
View Details