Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Salmonella paratyphi C ATP synthase subunit a (atpB)

This Recombinant Salmonella paratyphi C ATP synthase subunit a (atpB) spans the amino acid sequence from region 1-271.

Product Specifications

Product Name Alternative

ATP synthase subunit a, ATP synthase F0 sector subunit a, F-ATPase subunit 6

UniProt

C0Q2N8

Expression Region

1-271

Origin

Salmonella paratyphi C (strain RKS4594)

Field of Research

Infectious Disease & Virology; Immunology & Inflammation; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MASENMTPQEYIGHHLNNLQLDLRTFSLVDPQNPPATFWTLNIDSMFFSVVLGLLFLVMF RSVAKKATSGVPGKFQTAIELIVGFVHGSVKDMYHGKSKLIAPLALTIFVWVFLMNLMDL LPIDLLPYIAEHWLGLPATRVVPSADVNITLSMALGVFILILFYSIKMKGIGGFAKELTL QPFNHWAFIPVNLILEGVSLLSKPVSLGLRLFGNMYAGELIFILIAGLLPWWSQWILNVP WAIFHILIITLQAFIFMVLTIVYLSMASEEH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

YAP1 Mouse Monoclonal Antibody [Clone ID: OTI4B2]
CF813312 100 µg

YAP1 Mouse Monoclonal Antibody [Clone ID: OTI4B2]

Sign In for Pricing
View Details
LRRTM1 Mouse Monoclonal Antibody [Clone ID: OTI5C3]
CF805610 100 µg

LRRTM1 Mouse Monoclonal Antibody [Clone ID: OTI5C3]

Sign In for Pricing
View Details
RbBP5 Recombinant Rabbit Monoclonal Antibody [PSH0-16]
HA721274 100 µL

RbBP5 Recombinant Rabbit Monoclonal Antibody [PSH0-16]

Sign In for Pricing
View Details
Automatic Sealing And Capping Machine BLIH-104
BLIH-104 1 Unit

Automatic Sealing And Capping Machine BLIH-104

Sign In for Pricing
View Details
Rufy4 Mouse Gene Knockout Kit (CRISPR)
KN515204 1 Kit

Rufy4 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
DOK1 pTyr362 Rabbit Polyclonal Antibody
AP20860PU-N 100 µg

DOK1 pTyr362 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details