Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Synaptophysin-like protein 2 (SYPL2)

This Recombinant Human Synaptophysin-like protein 2 (SYPL2) spans the amino acid sequence from region 1-272.

Product Specifications

Product Name Alternative

Synaptophysin-like protein 2

UniProt

Q5VXT5

Expression Region

1-272

Origin

Homo sapiens (Human)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSSTESAGRTADKSPRQQVDRLLVGLRWRRLEEPLGFIKVLQWLFAIFAFGSCGSYSGET GAMVRCNNEAKDVSSIIVAFGYPFRLHRIQYEMPLCDEESSSKTMHLMGDFSAPAEFFVT LGIFSFFYTMAALVIYLRFHNLYTENKRFPLVDFCVTVSFTFFWLVAAAAWGKGLTDVKG ATRPSSLTAAMSVCHGEEAVCSAGATPSMGLANISVLFGFINFFLWAGNCWFVFKETPWH GQGQGQDQDQDQDQGQGPSQESAAEQGAVEKQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Blood Group Antigen B (CD173) (HEB-20), CF488A conjugate, 0.1mg/mL
BNC880296-100 1x 100 µL

Blood Group Antigen B (CD173) (HEB-20), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
N-Cadherin Polyclonal Antibody
E-AB-64010-01 60 µL

N-Cadherin Polyclonal Antibody

Sign In for Pricing
View Details
N-Cadherin Polyclonal Antibody
E-AB-64010-02 120 µL

N-Cadherin Polyclonal Antibody

Sign In for Pricing
View Details
N-Cadherin Polyclonal Antibody
E-AB-64010-03 200 µL

N-Cadherin Polyclonal Antibody

Sign In for Pricing
View Details
CD73 (Immuno-Oncology Target) (NT5E/2503), CF640R conjugate, 0.1mg/mL
BNC402503-500 1x 500 µL

CD73 (Immuno-Oncology Target) (NT5E/2503), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
RPE65 Mouse Monoclonal Antibody [Clone ID: OTI6C6]
CF815247 100 µg

RPE65 Mouse Monoclonal Antibody [Clone ID: OTI6C6]

Sign In for Pricing
View Details