Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Synaptophysin-like protein 2 (SYPL2)

This Recombinant Human Synaptophysin-like protein 2 (SYPL2) spans the amino acid sequence from region 1-272.

Product Specifications

Product Name Alternative

Synaptophysin-like protein 2

UniProt

Q5VXT5

Expression Region

1-272

Origin

Homo sapiens (Human)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSSTESAGRTADKSPRQQVDRLLVGLRWRRLEEPLGFIKVLQWLFAIFAFGSCGSYSGET GAMVRCNNEAKDVSSIIVAFGYPFRLHRIQYEMPLCDEESSSKTMHLMGDFSAPAEFFVT LGIFSFFYTMAALVIYLRFHNLYTENKRFPLVDFCVTVSFTFFWLVAAAAWGKGLTDVKG ATRPSSLTAAMSVCHGEEAVCSAGATPSMGLANISVLFGFINFFLWAGNCWFVFKETPWH GQGQGQDQDQDQDQGQGPSQESAAEQGAVEKQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ART3 Polyclonal Antibody
E-AB-14633-01 20 µL

ART3 Polyclonal Antibody

Sign In for Pricing
View Details
ART3 Polyclonal Antibody
E-AB-14633-02 60 µL

ART3 Polyclonal Antibody

Sign In for Pricing
View Details
ART3 Polyclonal Antibody
E-AB-14633-03 120 µL

ART3 Polyclonal Antibody

Sign In for Pricing
View Details
ART3 Polyclonal Antibody
E-AB-14633-04 200 µL

ART3 Polyclonal Antibody

Sign In for Pricing
View Details
CD31 / PECAM-1 (Endothelial Cell Marker) (C31/2876R), 0.2mg/mL
BNUB2876-100 1x 100 µL

CD31 / PECAM-1 (Endothelial Cell Marker) (C31/2876R), 0.2mg/mL

Sign In for Pricing
View Details
Steady-ATPTM HTS Viability Assay Kit, 10 x 1000 Assays
#30138-3 1 Kit

Steady-ATPTM HTS Viability Assay Kit, 10 x 1000 Assays

Sign In for Pricing
View Details