Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Synaptophysin-like protein 2 (SYPL2)

This Recombinant Human Synaptophysin-like protein 2 (SYPL2) spans the amino acid sequence from region 1-272.

Product Specifications

Product Name Alternative

Synaptophysin-like protein 2

UniProt

Q5VXT5

Expression Region

1-272

Origin

Homo sapiens (Human)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSSTESAGRTADKSPRQQVDRLLVGLRWRRLEEPLGFIKVLQWLFAIFAFGSCGSYSGET GAMVRCNNEAKDVSSIIVAFGYPFRLHRIQYEMPLCDEESSSKTMHLMGDFSAPAEFFVT LGIFSFFYTMAALVIYLRFHNLYTENKRFPLVDFCVTVSFTFFWLVAAAAWGKGLTDVKG ATRPSSLTAAMSVCHGEEAVCSAGATPSMGLANISVLFGFINFFLWAGNCWFVFKETPWH GQGQGQDQDQDQDQGQGPSQESAAEQGAVEKQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TM4SF4 (N-term) Rabbit Polyclonal Antibody
AP54133PU-N 400 µL

TM4SF4 (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
trans Resveratrol 3-O-beta-D-glucopyranoside, 98%
TRC-R150080-50MG 50 mg

trans Resveratrol 3-O-beta-D-glucopyranoside, 98%

Sign In for Pricing
View Details
[Leu5]-Enkephalin Acetate
TRC-L330340-25MG 25 mg

[Leu5]-Enkephalin Acetate

Sign In for Pricing
View Details
Frozen Tissue Blocks, Lung
CB512086 1 Block

Frozen Tissue Blocks, Lung

Sign In for Pricing
View Details
BrdU Recombinant Rabbit Monoclonal Antibody [PSH0-18]
HA721283 100 µL

BrdU Recombinant Rabbit Monoclonal Antibody [PSH0-18]

Sign In for Pricing
View Details
Cyclosporin D
TRC-C988910-50MG 50 mg

Cyclosporin D

Sign In for Pricing
View Details