Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Guillardia theta Chloroplast envelope membrane protein (cemA)

This Recombinant Guillardia theta Chloroplast envelope membrane protein (cemA) spans the amino acid sequence from region 1-278.

Product Specifications

Product Name Alternative

Chloroplast envelope membrane protein

UniProt

O78470

Expression Region

1-278

Origin

Guillardia theta (Cryptomonas phi)

Field of Research

Neuroscience; Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKNWRLNNVTESAFEKTGPIPRSIAKTFEKFKKELEPNSESEIIEEFRVSRYQTASSIKY LVLLVTVPLLINQASKSLVFSPFIDYFWNDNQSDIFLNESQEERAFSELQRFEEKIHFEI LIGQSPPLSQETIDKEIKNKAIELAQFYVQESTDAIKNLLADILAFITFAYLIFTGGRQI AVLKSFINELIYGLSDTAKAFLIILFTDIFVGFHSTHGWEVVLENGLRHFGLPENRDLIF LFIATFPVVLDTVFKYWIFRYLNQVSPSAVATYHEMNE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD7 (T3-3A1), CF568 conjugate, 0.1mg/mL
BNC680978-500 1x 500 µL

CD7 (T3-3A1), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Fibronectin (TV-1), CF594 conjugate, 0.1mg/mL
BNC940029-100 1x 100 µL

Fibronectin (TV-1), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Von Willebrand Factor (3E2D10), CF647 conjugate, 0.1mg/mL
BNC470633-100 1x 100 µL

Von Willebrand Factor (3E2D10), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Complement C4d (C4D204), CF488A conjugate, 0.1mg/mL
BNC880204-100 1x 100 µL

Complement C4d (C4D204), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD34 (Hematopoietic Stem Cell & Endothelial Marker) (HPCA1/2598R), CF647 conjugate, 0.1mg/mL
BNC472598-500 1x 500 µL

CD34 (Hematopoietic Stem Cell & Endothelial Marker) (HPCA1/2598R), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
C1QB / Complement C1q B-Chain (C1QB/2965), CF568 conjugate, 0.1mg/mL
BNC682965-100 1x 100 µL

C1QB / Complement C1q B-Chain (C1QB/2965), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details