Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Chloroplast envelope membrane protein (cemA)

This Recombinant Chloroplast envelope membrane protein (cemA) spans the amino acid sequence from region 1-278.

Product Specifications

Product Name Alternative

Chloroplast envelope membrane protein

UniProt

Q9TM16

Expression Region

1-278

Origin

Cyanidium caldarium

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKNWKFNKINYPTFEKSGAIPRSITKTFEKLKKELNPHSESEIIEEFTISRYQTIASLRY LIVLVVFPVVVHQVSKNFIIGPAVDYFWKYNQIDVFLNSSQEERAFAELQRFEEKIHFEM LIGTKQSVSQQSLEASIKQKAVEIADHYTYESLHAIKNILADSISISVFILLIVLGKRQT FVLKSFLNEIVYGLSDTAKAFLIILFTDMFIGFHSPHGWEVVIESLLRHFGLPENRDFIF LFIATFPVSLDTVFKYWIFRYLNQVSPSAVATYHNMNE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HhaI Restriction Endonucleases
E2190-01 2000 U

HhaI Restriction Endonucleases

Sign In for Pricing
View Details
Factor XI (G-2)
sc-365996 200 µg/mL

Factor XI (G-2)

Sign In for Pricing
View Details
Recombinant Rat PSPN Protein, His (Fc)-Avi-tagged
PSPN-4452R 50 µg

Recombinant Rat PSPN Protein, His (Fc)-Avi-tagged

Sign In for Pricing
View Details
RPL14 Antibody
DF8718-01 100 µL

RPL14 Antibody

Sign In for Pricing
View Details
RPL14 Antibody
DF8718-02 200 µL

RPL14 Antibody

Sign In for Pricing
View Details
Sodium Sulphite Anhydrous 95% Extrapure
02515 00500 500 g

Sodium Sulphite Anhydrous 95% Extrapure

Sign In for Pricing
View Details