Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Prolipoprotein diacylglyceryl transferase (lgt)

This Recombinant Staphylococcus aureus Prolipoprotein diacylglyceryl transferase (lgt) spans the amino acid sequence from region 1-279.

Product Specifications

Product Name Alternative

Prolipoprotein diacylglyceryl transferase, EC= 2.4.99.-

UniProt

A5IQW5

Expression Region

1-279

Origin

Staphylococcus aureus (strain JH9)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGIVFNYIDPVAFNLGPLSVRWYGIIIAVGILLGYFVAQRALVKAGLHKDTLVDIIFYSA LFGFIAARIYFVIFQWPYYAENPSEIIKIWHGGIAIHGGLIGGFIAGVIVCKVKNLNPFQ IGDIVAPSIILAQGIGRWGNFMNHEAHGGPVSRAFLEQLHLPNFIIENMYINGQYYHPTF LYESIWDVAGFIILVNIRKHLKLGETFFLYLTWYSIGRFFIEGLRTDSLMLTSNIRVAQL VSILLILISISLIVYRRIKYNPPLYSKVGALPWPTKKVK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HSP60 Rabbit pAb
E47R0191 100 µL

HSP60 Rabbit pAb

Sign In for Pricing
View Details
Rat C2h1orf52 Pre-designed siRNA Set A
SI201737A 1 Each

Rat C2h1orf52 Pre-designed siRNA Set A

Sign In for Pricing
View Details
Mouse Dipeptidase 2 ELISA Kit
MBS096855-01 48 Well

Mouse Dipeptidase 2 ELISA Kit

Sign In for Pricing
View Details
Mouse Dipeptidase 2 ELISA Kit
MBS096855-02 96 Well

Mouse Dipeptidase 2 ELISA Kit

Sign In for Pricing
View Details
Mouse Dipeptidase 2 ELISA Kit
MBS096855-03 5x 96 Well

Mouse Dipeptidase 2 ELISA Kit

Sign In for Pricing
View Details
Mouse Dipeptidase 2 ELISA Kit
MBS096855-04 10x 96 Well

Mouse Dipeptidase 2 ELISA Kit

Sign In for Pricing
View Details