Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Uncharacterized protein Rv0093c/MT0102 (Rv0093c, MT0102)

This Recombinant Uncharacterized protein Rv0093c/MT0102 (Rv0093c, MT0102) spans the amino acid sequence from region 1-282.

Product Specifications

Product Name Alternative

Uncharacterized protein Rv0093c/MT0102

UniProt

Q10890

Expression Region

1-282

Origin

Mycobacterium tuberculosis

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLAQATTAGSFNHHASTVLQGCRGVPAAMWSEPAGAIRRHCATIDGMDCEVAREALSARL DGERAPVPSARVDEHLGECSACRAWFTQVASQAGDLRRLAESRPVVPPVGRLGIRRAPRR QHSPMTWRRWALLCVGIAQIALGTVQGFGLDVGLTHQHPTGAGTHLLNESTSWSIALGVI MVGAALWPSAAAGLAGVLTAFVAILTGYVIVDALSGAVSTTRILTHLPVVIGAVLAIMVW RSASGPRPRPDAVAAEPDIVLPDNASRGRRRGHLWPTDGSAA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD100 (Semaphorin-4D) (A8), CF405S conjugate, 0.1mg/mL
BNC040218-100 1x 100 µL

CD100 (Semaphorin-4D) (A8), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD11a (Cris-3), CF640R conjugate, 0.1mg/mL
BNC400151-500 1x 500 µL

CD11a (Cris-3), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
ACTH (Adrenocorticotrophic Hormone) (AH26), CF594 conjugate, 0.1mg/mL
BNC940026-100 1x 100 µL

ACTH (Adrenocorticotrophic Hormone) (AH26), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Topoisomerase I, MT (TOP1MT/488), CF647 conjugate, 0.1mg/mL
BNC470488-500 1x 500 µL

Topoisomerase I, MT (TOP1MT/488), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD61 / Integrin 3 / Platelet Glycoprotein IIIa (Platelet Marker) (ITGB3/2166R), CF568 conjugate, 0.1mg/mL
BNC682166-500 1x 500 µL

CD61 / Integrin 3 / Platelet Glycoprotein IIIa (Platelet Marker) (ITGB3/2166R), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD10 (Membrane Metalloendopeptidase) (MME/2590), CF568 conjugate, 0.1mg/mL
BNC682590-500 1x 500 µL

CD10 (Membrane Metalloendopeptidase) (MME/2590), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details