Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Haemophilus influenzae Protease HtpX (htpX)

This Recombinant Haemophilus influenzae Protease HtpX (htpX) spans the amino acid sequence from region 1-283.

Product Specifications

Product Name Alternative

Protease HtpX, EC= 3.4.24.-, Heat shock protein HtpX

UniProt

A5UE05

Expression Region

1-283

Origin

Haemophilus influenzae (strain PittEE)

Field of Research

Protein Biochemistry

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MMRILLFLATNMAVMLVLGIILSVTGIAGNSTGGILIMALLFGFAGSLISLFLSKTMALR SVDGEVITQPRNQTERWLIDTVSRQAQKAGIPMPDVAIYHSPDVNAFATGATKSNSLVAV STGLLNNMTEAEAEAVLAHEISHISNGDMVTMALLQGVLNTFVIFLSRVIATAVASSRNN NGEETRSSGIYFLVSMVLEMLFGVLASIIAMWFSRYREFRADAGSASLVGKEKMIMALQR LQQLHEHQNLEGSLNAFMINGKRSELFMSHPPLEKRIEALRNL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Goat Protein Kinase D1 ELISA Kit
MBS750285-01 48 Well

Goat Protein Kinase D1 ELISA Kit

Sign In for Pricing
View Details
Goat Protein Kinase D1 ELISA Kit
MBS750285-02 96 Well

Goat Protein Kinase D1 ELISA Kit

Sign In for Pricing
View Details
Goat Protein Kinase D1 ELISA Kit
MBS750285-03 5x 96 Well

Goat Protein Kinase D1 ELISA Kit

Sign In for Pricing
View Details
Goat Protein Kinase D1 ELISA Kit
MBS750285-04 10x 96 Well

Goat Protein Kinase D1 ELISA Kit

Sign In for Pricing
View Details
PCMV6-DNAI1-3*FLAG
BZ67987 1 Vial

PCMV6-DNAI1-3*FLAG

Sign In for Pricing
View Details
Mouse Monoclonal IL-2 Antibody (5334) [Janelia Fluor 549]
FAB202I 0.1 mL

Mouse Monoclonal IL-2 Antibody (5334) [Janelia Fluor 549]

Sign In for Pricing
View Details