Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Haemophilus influenzae Protease HtpX (htpX)

This Recombinant Haemophilus influenzae Protease HtpX (htpX) spans the amino acid sequence from region 1-283.

Product Specifications

Product Name Alternative

Protease HtpX, EC= 3.4.24.-, Heat shock protein HtpX

UniProt

A5UE05

Expression Region

1-283

Origin

Haemophilus influenzae (strain PittEE)

Field of Research

Protein Biochemistry

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MMRILLFLATNMAVMLVLGIILSVTGIAGNSTGGILIMALLFGFAGSLISLFLSKTMALR SVDGEVITQPRNQTERWLIDTVSRQAQKAGIPMPDVAIYHSPDVNAFATGATKSNSLVAV STGLLNNMTEAEAEAVLAHEISHISNGDMVTMALLQGVLNTFVIFLSRVIATAVASSRNN NGEETRSSGIYFLVSMVLEMLFGVLASIIAMWFSRYREFRADAGSASLVGKEKMIMALQR LQQLHEHQNLEGSLNAFMINGKRSELFMSHPPLEKRIEALRNL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human FOXRED1, His-tagged
FOXRED1-12991H 25 µg

Recombinant Human FOXRED1, His-tagged

Sign In for Pricing
View Details
Anti-WIF1  Rabbit Monoclonal Antibody
MA5697-.05 50 µL

Anti-WIF1 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
CaMK2 alpha Recombinant Antibody, PE-Cy7 Conjugated
bsm-61318R-PE-Cy7-01 20 µL

CaMK2 alpha Recombinant Antibody, PE-Cy7 Conjugated

Sign In for Pricing
View Details
CaMK2 alpha Recombinant Antibody, PE-Cy7 Conjugated
bsm-61318R-PE-Cy7-02 100 µL

CaMK2 alpha Recombinant Antibody, PE-Cy7 Conjugated

Sign In for Pricing
View Details
Ob-R shRNA (m) Lentiviral Particles
sc-36116-V 200 µL

Ob-R shRNA (m) Lentiviral Particles

Sign In for Pricing
View Details
ZSCAN22, ID (ZSCAN22, HKR2, ZNF50, Zinc finger and SCAN domain-containing protein 22, Krueppel-related zinc finger protein 2, Protein HKR2, Zinc finger protein 50) (AP) discontinued
044416-AP 200 µL

ZSCAN22, ID (ZSCAN22, HKR2, ZNF50, Zinc finger and SCAN domain-containing protein 22, Krueppel-related zinc finger protein 2, Protein HKR2, Zinc finger protein 50) (AP) discontinued

Sign In for Pricing
View Details