Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Chromobacterium violaceum Prolipoprotein diacylglyceryl transferase (lgt)

This Recombinant Chromobacterium violaceum Prolipoprotein diacylglyceryl transferase (lgt) spans the amino acid sequence from region 1-283.

Product Specifications

Product Name Alternative

Prolipoprotein diacylglyceryl transferase, EC= 2.4.99.-

UniProt

Q7NYJ8

Expression Region

1-283

Origin

Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLIHPQFDPVAIHLGPLAVHWYGLMYLLGFALFLTMGKYRLKNGNDVLTVPQLDDMLMYG AVGVVVGGRLGEVLFYQPGYYFSHPLEIFMVWKGGMSFHGGFLGVLIAVAIYGRKVGRGF WQLTDFVAPLVPLGLAAGRVGNFINGELWGRVASPELPWAMLFPQARMEDIAEAQQSADL MNMLMQYGGLLRHPSQLYEFALEGIVLFGALWIYSAKPRATGKVSALFLIGYGLARFVSE YFRNPDAGIFGKSDVISMGQWLSLPMIVIGVALLVFFGRRKQG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD4 (EDU-2), CF647 conjugate, 0.1mg/mL
BNC470345-500 1x 500 µL

CD4 (EDU-2), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD5 (Cris-1), CF594 conjugate, 0.1mg/mL
BNC940176-100 1x 100 µL

CD5 (Cris-1), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD10 (CB-CALLA), CF405S conjugate, 0.1mg/mL
BNC040146-500 1x 500 µL

CD10 (CB-CALLA), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD74 (BU45), CF647 conjugate, 0.1mg/mL
BNC470189-100 1x 100 µL

CD74 (BU45), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
FOXP3 (3G3), CF555 conjugate, 0.1mg/mL
BNC550645-100 1x 100 µL

FOXP3 (3G3), CF555 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TRP1 (Tyrosinase Related Protein 1) (TYRP1/807), CF488A conjugate, 0.1mg/mL
BNC880807-500 1x 500 µL

TRP1 (Tyrosinase Related Protein 1) (TYRP1/807), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details