Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Translocase of inner mitochondrial membrane domain-containing protein 1 (Timmdc1)

This Recombinant Rat Translocase of inner mitochondrial membrane domain-containing protein 1 (Timmdc1) spans the amino acid sequence from region 1-285.

Product Specifications

Product Name Alternative

Translocase of inner mitochondrial membrane domain-containing protein 1

UniProt

Q6AY94

Expression Region

1-285

Origin

Rattus norvegicus (Rat)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEAPPPAPRSRLCGAWGPFPRVFAAGAVAADSQSFVEDPELRSYVSDPGSSESGWDRLRQ LFVKDEQRKISKEMDYICRAALSAGIIGWAYGGIPAFIYAKRRYIEQSQAEIYHNRFDAV QSAHRAATRGFIRYGWRWSWRTAVFVTIFNTVNTGLTVYRNKDALSHFAIAGAVTGGLFR INLGLRGLVAGGIIGALLGTPMGSLLMALEKHCGETVQERRQKDREAQQEQRLEEWRRNL QVTELLPMEIESGLEKIQPEKDAQRIEELLRLPRNPASPDKQSED

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD20 (B9E9), CF647 conjugate, 0.1mg/mL
BNC470160-100 1x 100 µL

CD20 (B9E9), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 17 (E3), CF594 conjugate, 0.1mg/mL
BNC940158-100 1x 100 µL

Cytokeratin 17 (E3), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 17 (E3), CF740 conjugate, 0.1mg/mL
BNC740158-500 1x 500 µL

Cytokeratin 17 (E3), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD46 (122.2), CF405S conjugate, 0.1mg/mL
BNC040175-500 1x 500 µL

CD46 (122.2), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD3e (B-B12), CF488A conjugate, 0.1mg/mL
BNC881052-100 1x 100 µL

CD3e (B-B12), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD31 / PECAM-1 (158-2B3), CF594 conjugate, 0.1mg/mL
BNC940352-500 1x 500 µL

CD31 / PECAM-1 (158-2B3), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details