Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Danio rerio Probable lipid phosphate phosphatase PPAPDC3 (ppapdc3)

This Recombinant Danio rerio Probable lipid phosphate phosphatase PPAPDC3 (ppapdc3) spans the amino acid sequence from region 1-287.

Product Specifications

Product Name Alternative

Probable lipid phosphate phosphatase PPAPDC3, EC= 3.1.3.-, Phosphatidic acid phosphatase type 2 domain-containing protein 3

UniProt

Q6P0E8

Expression Region

1-287

Origin

Danio rerio (Zebrafish) (Brachydanio rerio)

Field of Research

Metabolism Research; Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MPANQTRSRARERNNVLNRPEFMSLNQPIKSGGGGGGGESRGTARRPSQRQQQNQQQQGD NPQPENNKDKKELPEEDCMQLNPSFKGIAMNSLLAIDICMSKRLGVCAHPSSSWGSVRSM VKLLALTGHGIPWVFGTIVCLMRSNTLAGQEVLVNLLLALLLDVMTVSGMQKLVKRKGPW EMPPGFFDYLAMDIYSFPAAHASRAVMVSKFLLAHLVLAVPLRILLVLWAILVGISRVLL GRHHLTDVGCGFALGFLHYSLVEMVWLSSNTCQTLISIGTFNWSPLY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Sec3l1 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)
LV621688 1.0 µg DNA

Sec3l1 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)

Sign In for Pricing
View Details
Cyclin B1 (G2/Mitotic-specific Cyclin-B1, CCNB1, CCNB) (MaxLight 750)
MBS6232387-01 0.1 mL

Cyclin B1 (G2/Mitotic-specific Cyclin-B1, CCNB1, CCNB) (MaxLight 750)

Sign In for Pricing
View Details
Cyclin B1 (G2/Mitotic-specific Cyclin-B1, CCNB1, CCNB) (MaxLight 750)
MBS6232387-02 5x 0.1 mL

Cyclin B1 (G2/Mitotic-specific Cyclin-B1, CCNB1, CCNB) (MaxLight 750)

Sign In for Pricing
View Details
Human Melanoma-associated antigen D4 (MAGED4) ELISA Kit
abx388387 96 Tests

Human Melanoma-associated antigen D4 (MAGED4) ELISA Kit

Sign In for Pricing
View Details
DHH (Desert Hedgehog Protein, HHG-3, MGC35145) APC
MBS6136230-01 0.1 mL

DHH (Desert Hedgehog Protein, HHG-3, MGC35145) APC

Sign In for Pricing
View Details
DHH (Desert Hedgehog Protein, HHG-3, MGC35145) APC
MBS6136230-02 5x 0.1 mL

DHH (Desert Hedgehog Protein, HHG-3, MGC35145) APC

Sign In for Pricing
View Details