Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Danio rerio Probable lipid phosphate phosphatase PPAPDC3 (ppapdc3)

This Recombinant Danio rerio Probable lipid phosphate phosphatase PPAPDC3 (ppapdc3) spans the amino acid sequence from region 1-287.

Product Specifications

Product Name Alternative

Probable lipid phosphate phosphatase PPAPDC3, EC= 3.1.3.-, Phosphatidic acid phosphatase type 2 domain-containing protein 3

UniProt

Q6P0E8

Expression Region

1-287

Origin

Danio rerio (Zebrafish) (Brachydanio rerio)

Field of Research

Metabolism Research; Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MPANQTRSRARERNNVLNRPEFMSLNQPIKSGGGGGGGESRGTARRPSQRQQQNQQQQGD NPQPENNKDKKELPEEDCMQLNPSFKGIAMNSLLAIDICMSKRLGVCAHPSSSWGSVRSM VKLLALTGHGIPWVFGTIVCLMRSNTLAGQEVLVNLLLALLLDVMTVSGMQKLVKRKGPW EMPPGFFDYLAMDIYSFPAAHASRAVMVSKFLLAHLVLAVPLRILLVLWAILVGISRVLL GRHHLTDVGCGFALGFLHYSLVEMVWLSSNTCQTLISIGTFNWSPLY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Equilenin Sulfate Sodium Salt
CS-T-21882 1 Each

Equilenin Sulfate Sodium Salt

Sign In for Pricing
View Details
Nrarp (C-12) Alexa Fluor® 546
sc-515015 AF546 200 µg/mL

Nrarp (C-12) Alexa Fluor® 546

Sign In for Pricing
View Details
9- (2,5-d|Dioxo-L-3-amino-1-pyrrolidineacetic acid) -10-deglycine Daptomycin
440315-01 500 µg

9- (2,5-d|Dioxo-L-3-amino-1-pyrrolidineacetic acid) -10-deglycine Daptomycin

Sign In for Pricing
View Details
9- (2,5-d|Dioxo-L-3-amino-1-pyrrolidineacetic acid) -10-deglycine Daptomycin
440315-02 5 mg

9- (2,5-d|Dioxo-L-3-amino-1-pyrrolidineacetic acid) -10-deglycine Daptomycin

Sign In for Pricing
View Details
EIF1 (C-term) Rabbit pAb
E2618091 100 µL

EIF1 (C-term) Rabbit pAb

Sign In for Pricing
View Details
Human RPL23A Protein
orb428184-01 2 µg

Human RPL23A Protein

Sign In for Pricing
View Details