Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Protease HtpX (htpX)

This Recombinant Protease HtpX (htpX) spans the amino acid sequence from region 1-289.

Product Specifications

Product Name Alternative

Protease HtpX, EC= 3.4.24.-, Heat shock protein HtpX

UniProt

Q9PA93

Expression Region

1-289

Origin

Xylella fastidiosa

Field of Research

Protein Biochemistry

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLTRIVLFAITNLAVLILASIVMSLLGVNPTQMSGLLVMALIFGFAGSFISLLMSKAIAK RTTGAYVIDQPRNLSERWLLDTVSRQAEIVGIGRPEIAIYEGVEINAFATGADRNNALVA VSTGLLQNMSQDEVEAVLGHEIAHVANGDMVTMALLQGVLNTFVIVLARVVGGFIDSLLS GNRGGARGVAYYAIVLVLELLFGLFATMITMWFSRRREFRADEGGAYLAGRNKMIAALER LGINHGQSTLPTQVQAFGIYGGIGEGLRKLFLSHPPLSERIAALRVARQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Leptin (116-130) Mouse Peptide
PE-55148-01 1 mg

Leptin (116-130) Mouse Peptide

Sign In for Pricing
View Details
Leptin (116-130) Mouse Peptide
PE-55148-02 5 mg

Leptin (116-130) Mouse Peptide

Sign In for Pricing
View Details
Leptin (116-130) Mouse Peptide
PE-55148-03 10 mg

Leptin (116-130) Mouse Peptide

Sign In for Pricing
View Details
Canine Mitochondrial brown fat uncoupling protein 1 (UCP1) ELISA Kit
MBS2603841-01 48 Well

Canine Mitochondrial brown fat uncoupling protein 1 (UCP1) ELISA Kit

Sign In for Pricing
View Details
Canine Mitochondrial brown fat uncoupling protein 1 (UCP1) ELISA Kit
MBS2603841-02 96 Well

Canine Mitochondrial brown fat uncoupling protein 1 (UCP1) ELISA Kit

Sign In for Pricing
View Details
Canine Mitochondrial brown fat uncoupling protein 1 (UCP1) ELISA Kit
MBS2603841-03 5x 96 Well

Canine Mitochondrial brown fat uncoupling protein 1 (UCP1) ELISA Kit

Sign In for Pricing
View Details