Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus subtilis Uncharacterized transporter ydbO (ydbO)

This Recombinant Bacillus subtilis Uncharacterized transporter ydbO (ydbO) spans the amino acid sequence from region 1-290.

Product Specifications

Product Name Alternative

Uncharacterized transporter ydbO

UniProt

P96610

Expression Region

1-290

Origin

Bacillus subtilis (strain 168)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MERTENLKKGEKGALLNIFAYVILAVVKLVIGILYHSEALRADGLNNGTDIVASVAVLIG LRISQRPADSDHPYGHYRAETISSLVASFIMMAVGIEVLIGGGKAIAGGTTETPNLIAAW TALGSAVFMYGIYLYNKRLAASIKSSALMAAAKDSRSDAFVSAGAFIGVFSSQLKLPWVD PVTAFIIGIIICKTAWDIFKDASHSLTDGFHLKDLEPYKQTVGRIENVHRLKDVKARYLG STVHIEMVITVDPKLTVEEGHGVADEVEDKIKHEHDVTHVHVHVEPDDIK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Phospho-MAPT (Thr212) Antibody
CSB-PA237372 100 µL

Phospho-MAPT (Thr212) Antibody

Sign In for Pricing
View Details
ERAP1 Protein Vector (Human) (pPM-C-HA)
19395021 500 ng

ERAP1 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
Dipotassium Tetrachloroplatinate
D5880-01 1 g

Dipotassium Tetrachloroplatinate

Sign In for Pricing
View Details
Dipotassium Tetrachloroplatinate
D5880-02 5 g

Dipotassium Tetrachloroplatinate

Sign In for Pricing
View Details
4- (N-Propionylsulfamoyl) phenylboronic acid
429665-01 25 mg

4- (N-Propionylsulfamoyl) phenylboronic acid

Sign In for Pricing
View Details
4- (N-Propionylsulfamoyl) phenylboronic acid
429665-02 50 mg

4- (N-Propionylsulfamoyl) phenylboronic acid

Sign In for Pricing
View Details