Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus subtilis Uncharacterized transporter ydbO (ydbO)

This Recombinant Bacillus subtilis Uncharacterized transporter ydbO (ydbO) spans the amino acid sequence from region 1-290.

Product Specifications

Product Name Alternative

Uncharacterized transporter ydbO

UniProt

P96610

Expression Region

1-290

Origin

Bacillus subtilis (strain 168)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MERTENLKKGEKGALLNIFAYVILAVVKLVIGILYHSEALRADGLNNGTDIVASVAVLIG LRISQRPADSDHPYGHYRAETISSLVASFIMMAVGIEVLIGGGKAIAGGTTETPNLIAAW TALGSAVFMYGIYLYNKRLAASIKSSALMAAAKDSRSDAFVSAGAFIGVFSSQLKLPWVD PVTAFIIGIIICKTAWDIFKDASHSLTDGFHLKDLEPYKQTVGRIENVHRLKDVKARYLG STVHIEMVITVDPKLTVEEGHGVADEVEDKIKHEHDVTHVHVHVEPDDIK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

1- ((4- ((4-Hydroxyphenyl) sulfonyl) phenoxy) sulfonyl) pyridin-1-ium
407399-01 100 mg

1- ((4- ((4-Hydroxyphenyl) sulfonyl) phenoxy) sulfonyl) pyridin-1-ium

Sign In for Pricing
View Details
1- ((4- ((4-Hydroxyphenyl) sulfonyl) phenoxy) sulfonyl) pyridin-1-ium
407399-02 250 mg

1- ((4- ((4-Hydroxyphenyl) sulfonyl) phenoxy) sulfonyl) pyridin-1-ium

Sign In for Pricing
View Details
Rabbit Polyclonal PPHLN1 Antibody [Alexa Fluor 700]
NBP2-81775AF700 0.1 mL

Rabbit Polyclonal PPHLN1 Antibody [Alexa Fluor 700]

Sign In for Pricing
View Details
Mouse Monoclonal TRAILR2/TNFRSF10B Antibody (B-D37) [DyLight 488]
NBP3-14579G 0.1 mL

Mouse Monoclonal TRAILR2/TNFRSF10B Antibody (B-D37) [DyLight 488]

Sign In for Pricing
View Details
Hydroxyapatite 20 nm
B2016268 2 g

Hydroxyapatite 20 nm

Sign In for Pricing
View Details
Rabbit anti-Schizosaccharomyces pombe (strain 972/24843)(Fission yeast) KRI1 Polyclonal Antibody
MBS7187431 Inquire

Rabbit anti-Schizosaccharomyces pombe (strain 972/24843)(Fission yeast) KRI1 Polyclonal Antibody

Sign In for Pricing
View Details