Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus subtilis Uncharacterized transporter ydbO (ydbO)

This Recombinant Bacillus subtilis Uncharacterized transporter ydbO (ydbO) spans the amino acid sequence from region 1-290.

Product Specifications

Product Name Alternative

Uncharacterized transporter ydbO

UniProt

P96610

Expression Region

1-290

Origin

Bacillus subtilis (strain 168)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MERTENLKKGEKGALLNIFAYVILAVVKLVIGILYHSEALRADGLNNGTDIVASVAVLIG LRISQRPADSDHPYGHYRAETISSLVASFIMMAVGIEVLIGGGKAIAGGTTETPNLIAAW TALGSAVFMYGIYLYNKRLAASIKSSALMAAAKDSRSDAFVSAGAFIGVFSSQLKLPWVD PVTAFIIGIIICKTAWDIFKDASHSLTDGFHLKDLEPYKQTVGRIENVHRLKDVKARYLG STVHIEMVITVDPKLTVEEGHGVADEVEDKIKHEHDVTHVHVHVEPDDIK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PCTP-L/STARD10/PCTP Rabbit Polyclonal Antibody (PE)
orb2590623 100 µg

PCTP-L/STARD10/PCTP Rabbit Polyclonal Antibody (PE)

Sign In for Pricing
View Details
ALK shRNA Plasmid (r)
sc-108078-SH 20 µg

ALK shRNA Plasmid (r)

Sign In for Pricing
View Details
BX-912
B1765-5 5 mg

BX-912

Sign In for Pricing
View Details
WDR41 Protein Vector (Mouse) (pPM-C-HA)
PV247068 500 ng

WDR41 Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
Ribonuclease H1 (RNase H1, RNASEH1, RNH1, Ribonuclease H Type II, H1RNA) (MaxLight 405)
MBS6192308-01 0.1 mL

Ribonuclease H1 (RNase H1, RNASEH1, RNH1, Ribonuclease H Type II, H1RNA) (MaxLight 405)

Sign In for Pricing
View Details
Ribonuclease H1 (RNase H1, RNASEH1, RNH1, Ribonuclease H Type II, H1RNA) (MaxLight 405)
MBS6192308-02 5x 0.1 mL

Ribonuclease H1 (RNase H1, RNASEH1, RNH1, Ribonuclease H Type II, H1RNA) (MaxLight 405)

Sign In for Pricing
View Details