Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Ureaplasma parvum serovar 3 Uncharacterized protein UU183 (UU183)

This Recombinant Ureaplasma parvum serovar 3 Uncharacterized protein UU183 (UU183) spans the amino acid sequence from region 1-291.

Product Specifications

Product Name Alternative

Uncharacterized protein UU183

UniProt

Q9PQW0

Expression Region

1-291

Origin

Ureaplasma parvum serovar 3 (strain ATCC 700970)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDKKAKIYTWSHIILIVFSLVCLHWFFILSITIPNQTGFLINRVGQWINSSSTYAYKIDP RSLFYLNYTLNFNIALNASGIASIVLFICYILTFIFNLIMIGIIRSWRPSLLHLIIAILI WLAILYLFIIIMIKPNFNQIINNSYYTWLKNVIFNDQTLTLNKKNVILNTYINHYHLPII NDPQVALLDISKHQINNENLTFNPSYNYNANLYFTKAKLIYCTYTIIGIIFIISFIYYLS EIIKRCLLVNDNWKIKQHERKDGLNIKKRKNKQEIVAPDPILEEIFKELDL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-BCMA Antibody, Rabbit Polyclonal
MBS8103388-01 0.1 mL

Anti-BCMA Antibody, Rabbit Polyclonal

Sign In for Pricing
View Details
Anti-BCMA Antibody, Rabbit Polyclonal
MBS8103388-02 5x 0.1 mL

Anti-BCMA Antibody, Rabbit Polyclonal

Sign In for Pricing
View Details
PYCR2 (Pyrroline-5-carboxylate Reductase 2, P5C Reductase 2, P5CR 2, P5CR2) (FITC)
132130-FITC 100 µL

PYCR2 (Pyrroline-5-carboxylate Reductase 2, P5C Reductase 2, P5CR 2, P5CR2) (FITC)

Sign In for Pricing
View Details
BAFF/BLyS Protein, Canine, Recombinant (hFc Tag)
E45O55009M3-50 50 µg

BAFF/BLyS Protein, Canine, Recombinant (hFc Tag)

Sign In for Pricing
View Details
Serpinf1 Polyclonal Antibody, FITC Conjugated
A50478-050 50 µL

Serpinf1 Polyclonal Antibody, FITC Conjugated

Sign In for Pricing
View Details
Anti-Mouse CD22 Monoclonal Antibody (PE/Cy7 Conjugated)
MBS2558152-01 50 Tests

Anti-Mouse CD22 Monoclonal Antibody (PE/Cy7 Conjugated)

Sign In for Pricing
View Details