Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Ureaplasma parvum serovar 3 Uncharacterized protein UU183 (UU183)

This Recombinant Ureaplasma parvum serovar 3 Uncharacterized protein UU183 (UU183) spans the amino acid sequence from region 1-291.

Product Specifications

Product Name Alternative

Uncharacterized protein UU183

UniProt

Q9PQW0

Expression Region

1-291

Origin

Ureaplasma parvum serovar 3 (strain ATCC 700970)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDKKAKIYTWSHIILIVFSLVCLHWFFILSITIPNQTGFLINRVGQWINSSSTYAYKIDP RSLFYLNYTLNFNIALNASGIASIVLFICYILTFIFNLIMIGIIRSWRPSLLHLIIAILI WLAILYLFIIIMIKPNFNQIINNSYYTWLKNVIFNDQTLTLNKKNVILNTYINHYHLPII NDPQVALLDISKHQINNENLTFNPSYNYNANLYFTKAKLIYCTYTIIGIIFIISFIYYLS EIIKRCLLVNDNWKIKQHERKDGLNIKKRKNKQEIVAPDPILEEIFKELDL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tert-Butyl 5-aminoisoindoline-2-carboxylate
OR76391-01 100 mg

Tert-Butyl 5-aminoisoindoline-2-carboxylate

Sign In for Pricing
View Details
Tert-Butyl 5-aminoisoindoline-2-carboxylate
OR76391-02 1 g

Tert-Butyl 5-aminoisoindoline-2-carboxylate

Sign In for Pricing
View Details
Tert-Butyl 5-aminoisoindoline-2-carboxylate
OR76391-03 5 g

Tert-Butyl 5-aminoisoindoline-2-carboxylate

Sign In for Pricing
View Details
Tert-Butyl 5-aminoisoindoline-2-carboxylate
OR76391-04 10 g

Tert-Butyl 5-aminoisoindoline-2-carboxylate

Sign In for Pricing
View Details
Tert-Butyl 5-aminoisoindoline-2-carboxylate
OR76391-05 25 g

Tert-Butyl 5-aminoisoindoline-2-carboxylate

Sign In for Pricing
View Details
MARK3 (NM_001128921) Human Over-expression Lysate
LC427023 20 µg

MARK3 (NM_001128921) Human Over-expression Lysate

Sign In for Pricing
View Details