Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Salmonella paratyphi A Protease HtpX (htpX)

This Recombinant Salmonella paratyphi A Protease HtpX (htpX) spans the amino acid sequence from region 1-293.

Product Specifications

Product Name Alternative

Protease HtpX, EC= 3.4.24.-, Heat shock protein HtpX

UniProt

B5BHB2

Expression Region

1-293

Origin

Salmonella paratyphi A (strain AKU_12601)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MMRIALFLLTNLAVMVVFGLVLSLTGIQSSSVQGLLIMALLFGFGGSFISLLMSKWMALK SVGGEVIEQPRNERERWLMNTVATQARQAGIAMPQVAIYHAPDINAFATGARRDASLVAV STGLLQNMSPDEAEAVIAHEISHIANGDMVTMTLIQGVVNTFVIFISRIIAQIAAGFLGG NRDEGEGSNGNPLIYFAVATVLELVFGILASIITMWFSRYREFHADAGSAKLVGREKMIA ALQRLKTSYEPQEATSMMAFCINGKSKSLSELFMTHPPLDKRIEALRSGEYLK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Monoclonal Antibody to Human CD23 (Clone: 152-5E5)
10-4175-100 100 µg

Monoclonal Antibody to Human CD23 (Clone: 152-5E5)

Sign In for Pricing
View Details
Recombinant Rat Vascular Endothelial Growth Factor, His Tag
MBS140676-01 0.002 mg

Recombinant Rat Vascular Endothelial Growth Factor, His Tag

Sign In for Pricing
View Details
Recombinant Rat Vascular Endothelial Growth Factor, His Tag
MBS140676-02 0.01 mg

Recombinant Rat Vascular Endothelial Growth Factor, His Tag

Sign In for Pricing
View Details
Recombinant Rat Vascular Endothelial Growth Factor, His Tag
MBS140676-03 0.1 mg

Recombinant Rat Vascular Endothelial Growth Factor, His Tag

Sign In for Pricing
View Details
Recombinant Rat Vascular Endothelial Growth Factor, His Tag
MBS140676-04 5x 0.1 mg

Recombinant Rat Vascular Endothelial Growth Factor, His Tag

Sign In for Pricing
View Details
Human Alanine Aminotransferase (ALT/GPT) ELISA Kit
201-12-1338 96 Tests

Human Alanine Aminotransferase (ALT/GPT) ELISA Kit

Sign In for Pricing
View Details