Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Salmonella paratyphi A Protease HtpX (htpX)

This Recombinant Salmonella paratyphi A Protease HtpX (htpX) spans the amino acid sequence from region 1-293.

Product Specifications

Product Name Alternative

Protease HtpX, EC= 3.4.24.-, Heat shock protein HtpX

UniProt

B5BHB2

Expression Region

1-293

Origin

Salmonella paratyphi A (strain AKU_12601)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MMRIALFLLTNLAVMVVFGLVLSLTGIQSSSVQGLLIMALLFGFGGSFISLLMSKWMALK SVGGEVIEQPRNERERWLMNTVATQARQAGIAMPQVAIYHAPDINAFATGARRDASLVAV STGLLQNMSPDEAEAVIAHEISHIANGDMVTMTLIQGVVNTFVIFISRIIAQIAAGFLGG NRDEGEGSNGNPLIYFAVATVLELVFGILASIITMWFSRYREFHADAGSAKLVGREKMIA ALQRLKTSYEPQEATSMMAFCINGKSKSLSELFMTHPPLDKRIEALRSGEYLK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RPL36AP54-set siRNA/shRNA/RNAi Lentivector (Human)
41582091 4x 500 ng

RPL36AP54-set siRNA/shRNA/RNAi Lentivector (Human)

Sign In for Pricing
View Details
Cy7 triethylammonium salt
C8592-5 5 mg

Cy7 triethylammonium salt

Sign In for Pricing
View Details
ARHGAP20 Protein Vector (Rat) (pPB-N-His)
PV254343 500 ng

ARHGAP20 Protein Vector (Rat) (pPB-N-His)

Sign In for Pricing
View Details
MIR3921 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)
LV768601 1.0 µg DNA

MIR3921 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)

Sign In for Pricing
View Details
Rat Hlf Pre-designed siRNA Set A
SI206273A 1 Each

Rat Hlf Pre-designed siRNA Set A

Sign In for Pricing
View Details
Human Dipeptidase 2 (DPEP2) ELISA Kit
DLR-DPEP2-Hu-01 48 Tests

Human Dipeptidase 2 (DPEP2) ELISA Kit

Sign In for Pricing
View Details