Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Protein YIF1A (Yif1a)

This Recombinant Mouse Protein YIF1A (Yif1a) spans the amino acid sequence from region 1-293.

Product Specifications

Product Name Alternative

Protein YIF1A, YIP1-interacting factor homolog A

UniProt

Q91XB7

Expression Region

1-293

Origin

Mus musculus (Mouse)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAYHSAYGVHGSKHRTRAAPDPPPLFDDTSGGYSSQLGGYPAPGADVAFSVNNLLGDPVA NMAMAYGTSIASQGKDIVHKELHRFVSVNKLKYFFAVDTAYVAKKLGLLVFPYTHQNWKM QYSHDVPLPPRKDLNAPDLYIPTMAFITYVLLAGMALGIQQRFSPEVLGLCASTALVWVF MEVLALLLGLYLATVRSELSTFHLLAYSGYKYVGMILSVLTGLLFGSDGYYVALAWTSSA LMYFIVRSLRTAASGPDSMGGPAPRQRLQLYLTLGAAAFQPLIIYWLTFHLVR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LANCL1 (NM_006055) Human Tagged Lenti ORF Clone
RC205279L4 10 µg

LANCL1 (NM_006055) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Catenin-α1 polyclonal antibody
BS6976 50ul

Catenin-α1 polyclonal antibody

Sign In for Pricing
View Details
RPL6 Protein Vector (Rat) (pPM-C-His)
PV302297 500 ng

RPL6 Protein Vector (Rat) (pPM-C-His)

Sign In for Pricing
View Details
Mouse Monoclonal Gastrin Antibody (GAST/2631) [DyLight 650]
NBP3-08657C 100 µL

Mouse Monoclonal Gastrin Antibody (GAST/2631) [DyLight 650]

Sign In for Pricing
View Details
Anti-CD34 [My10]
MBS488220-01 0.2 mg

Anti-CD34 [My10]

Sign In for Pricing
View Details
Anti-CD34 [My10]
MBS488220-02 5x 0.2 mg

Anti-CD34 [My10]

Sign In for Pricing
View Details