Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Protein YIF1A (Yif1a)

This Recombinant Mouse Protein YIF1A (Yif1a) spans the amino acid sequence from region 1-293.

Product Specifications

Product Name Alternative

Protein YIF1A, YIP1-interacting factor homolog A

UniProt

Q91XB7

Expression Region

1-293

Origin

Mus musculus (Mouse)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAYHSAYGVHGSKHRTRAAPDPPPLFDDTSGGYSSQLGGYPAPGADVAFSVNNLLGDPVA NMAMAYGTSIASQGKDIVHKELHRFVSVNKLKYFFAVDTAYVAKKLGLLVFPYTHQNWKM QYSHDVPLPPRKDLNAPDLYIPTMAFITYVLLAGMALGIQQRFSPEVLGLCASTALVWVF MEVLALLLGLYLATVRSELSTFHLLAYSGYKYVGMILSVLTGLLFGSDGYYVALAWTSSA LMYFIVRSLRTAASGPDSMGGPAPRQRLQLYLTLGAAAFQPLIIYWLTFHLVR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Goat Arrestin domain containing protein 5 (ARRDC5) ELISA Kit
GTR10326115 96 Well

Goat Arrestin domain containing protein 5 (ARRDC5) ELISA Kit

Sign In for Pricing
View Details
Mouse Monoclonal TRPC6 Antibody (TRPC6/7671) [Janelia Fluor 669]
NBP3-27020JF669 0.1 mL

Mouse Monoclonal TRPC6 Antibody (TRPC6/7671) [Janelia Fluor 669]

Sign In for Pricing
View Details
Bak, BH3 Domain (Bcl-2 Homologous Antagonist/Killer, Apoptosis Regulator BAK, Bcl-2-like Protein 7, Bcl2-L-7, BAK1, BCL2L7, CDN1) (Biotin)
B0055-10D-Biotin 200 µL

Bak, BH3 Domain (Bcl-2 Homologous Antagonist/Killer, Apoptosis Regulator BAK, Bcl-2-like Protein 7, Bcl2-L-7, BAK1, BCL2L7, CDN1) (Biotin)

Sign In for Pricing
View Details
NEDD9 Protein Vector (Human) (pPB-C-His)
PV028053 500 ng

NEDD9 Protein Vector (Human) (pPB-C-His)

Sign In for Pricing
View Details
C8orfK29 Rabbit pAb, Pacific Blue conjugated
orb2855695 100 µL

C8orfK29 Rabbit pAb, Pacific Blue conjugated

Sign In for Pricing
View Details
DUSP14 (Dual Specificity Protein Phosphatase 14, Mitogen-activated Protein Kinase Phosphatase 6, MAP Kinase Phosphatase 6, MKP6, MKP-6, MKP-1-like Protein Tyrosine Phosphatase, MKP-L)
126055 50 µg

DUSP14 (Dual Specificity Protein Phosphatase 14, Mitogen-activated Protein Kinase Phosphatase 6, MAP Kinase Phosphatase 6, MKP6, MKP-6, MKP-1-like Protein Tyrosine Phosphatase, MKP-L)

Sign In for Pricing
View Details