Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Thioalkalivibrio sp. Protease HtpX (htpX)

This Recombinant Thioalkalivibrio sp. Protease HtpX (htpX) spans the amino acid sequence from region 1-295.

Product Specifications

Product Name Alternative

Protease HtpX, EC= 3.4.24.-, Heat shock protein HtpX

UniProt

B8GTV4

Expression Region

1-295

Origin

Thioalkalivibrio sp. (strain HL-EbGR7)

Field of Research

Protein Biochemistry

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKRIFLFLATNLAIIVVLSIVLRLLGVERILDESGTNLNLNALLIFAAVFGFGGSFISLA ISKWMAKKTMRVHVIEQPRNSTEQWLLETVRRQAREAGIGMPEVGIFNSPDPNAFATGMS KNNALVAVSTGLMDRMNADEVEAVLGHEVAHVANGDMVTLALIQGVVNTFVIFLARVVGH FVDRVVFKNEQGHGPAFWITTIVAEIVFAILASIIVMWFSRQREFRADAGGARLAGREKM ISALEKLRAVHTPSQMPDQMAAFGIRGGMGQGLKKLFMSHPPLEERIMALKAMQR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Frozen Tissue Sections, Liver
CS634497 5x 5 µm

Frozen Tissue Sections, Liver

Sign In for Pricing
View Details
MHC II (HLA-DRA) (19-26.1), CF594 conjugate, 0.1mg/mL
BNC941082-500 1x 500 µL

MHC II (HLA-DRA) (19-26.1), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Recombinant Human 4-1BB/TNFRSF9 Protein (Fc & His Tag)
PKSH032027-01 10 µg

Recombinant Human 4-1BB/TNFRSF9 Protein (Fc & His Tag)

Sign In for Pricing
View Details
Recombinant Human 4-1BB/TNFRSF9 Protein (Fc & His Tag)
PKSH032027-02 50 µg

Recombinant Human 4-1BB/TNFRSF9 Protein (Fc & His Tag)

Sign In for Pricing
View Details
FE65 (APBB1) (NM_001164) Human Over-expression Lysate
LY400467 100 µg

FE65 (APBB1) (NM_001164) Human Over-expression Lysate

Sign In for Pricing
View Details
Tissue FFPE Sections, Prostate
CS706091 5x 5 µm

Tissue FFPE Sections, Prostate

Sign In for Pricing
View Details