Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Thioalkalivibrio sp. Protease HtpX (htpX)

This Recombinant Thioalkalivibrio sp. Protease HtpX (htpX) spans the amino acid sequence from region 1-295.

Product Specifications

Product Name Alternative

Protease HtpX, EC= 3.4.24.-, Heat shock protein HtpX

UniProt

B8GTV4

Expression Region

1-295

Origin

Thioalkalivibrio sp. (strain HL-EbGR7)

Field of Research

Protein Biochemistry

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKRIFLFLATNLAIIVVLSIVLRLLGVERILDESGTNLNLNALLIFAAVFGFGGSFISLA ISKWMAKKTMRVHVIEQPRNSTEQWLLETVRRQAREAGIGMPEVGIFNSPDPNAFATGMS KNNALVAVSTGLMDRMNADEVEAVLGHEVAHVANGDMVTLALIQGVVNTFVIFLARVVGH FVDRVVFKNEQGHGPAFWITTIVAEIVFAILASIIVMWFSRQREFRADAGGARLAGREKM ISALEKLRAVHTPSQMPDQMAAFGIRGGMGQGLKKLFMSHPPLEERIMALKAMQR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NXF1 Recombinant Rabbit Monoclonal Antibody [JE40-63]
ET7109-12 100 µL

NXF1 Recombinant Rabbit Monoclonal Antibody [JE40-63]

Sign In for Pricing
View Details
Tissue FFPE Sections, Liver
CS803214 5x 5 µm

Tissue FFPE Sections, Liver

Sign In for Pricing
View Details
ReadiLink™ Rapid iFluor® 790 Antibody Labeling Kit *Microscale Optimized for Labeling 50 μg Antibody Per Reaction*
1265-AAT 2 Labelings

ReadiLink™ Rapid iFluor® 790 Antibody Labeling Kit *Microscale Optimized for Labeling 50 μg Antibody Per Reaction*

Sign In for Pricing
View Details
Glycolysis Antibody Sampler Kit II
HAK21101 1 Kit

Glycolysis Antibody Sampler Kit II

Sign In for Pricing
View Details
rel-(2R,3R)-6-[Alpha-(2-Ethoxyphenoxy)benzyl]morpholin-3-one
TRC-E892650-5MG 5 mg

rel-(2R,3R)-6-[Alpha-(2-Ethoxyphenoxy)benzyl]morpholin-3-one

Sign In for Pricing
View Details
Calcium Gluconate
TRC-C145500-50G 50 g

Calcium Gluconate

Sign In for Pricing
View Details